Lus10017202 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G59860 55 / 9e-10 HSP20-like chaperones superfamily protein (.1)
AT1G53540 54 / 2e-09 HSP20-like chaperones superfamily protein (.1)
AT1G07400 54 / 4e-09 HSP20-like chaperones superfamily protein (.1)
AT2G29500 52 / 8e-09 HSP20-like chaperones superfamily protein (.1)
AT5G59720 52 / 1e-08 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1)
AT3G46230 52 / 1e-08 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1)
AT4G10250 43 / 3e-05 ATHSP22.0 HSP20-like chaperones superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021109 170 / 6e-54 AT1G07400 95 / 6e-25 HSP20-like chaperones superfamily protein (.1)
Lus10040830 56 / 6e-10 AT1G53540 236 / 6e-81 HSP20-like chaperones superfamily protein (.1)
Lus10009085 55 / 1e-09 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1)
Lus10016457 54 / 3e-09 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1)
Lus10016458 54 / 4e-09 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016456 54 / 4e-09 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1)
Lus10040723 53 / 8e-09 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1)
Lus10040722 52 / 1e-08 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1)
Lus10021503 51 / 1e-08 AT1G07400 82 / 3e-21 HSP20-like chaperones superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G081250 56 / 3e-10 AT2G29500 182 / 6e-60 HSP20-like chaperones superfamily protein (.1)
Potri.009G049800 55 / 8e-10 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1)
Potri.008G062350 54 / 2e-09 AT5G59720 196 / 3e-65 heat shock protein 18.2 (.1)
Potri.008G062300 54 / 2e-09 AT5G59720 198 / 9e-66 heat shock protein 18.2 (.1)
Potri.004G187450 54 / 2e-09 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1)
Potri.009G147900 54 / 3e-09 AT2G29500 193 / 5e-64 HSP20-like chaperones superfamily protein (.1)
Potri.019G081200 53 / 5e-09 AT2G29500 186 / 3e-61 HSP20-like chaperones superfamily protein (.1)
Potri.009G049900 53 / 6e-09 AT2G29500 154 / 2e-48 HSP20-like chaperones superfamily protein (.1)
Potri.010G195700 52 / 9e-09 AT5G59720 190 / 1e-62 heat shock protein 18.2 (.1)
Potri.009G039200 52 / 1e-08 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF00011 HSP20 Hsp20/alpha crystallin family
Representative CDS sequence
>Lus10017202 pacid=23165830 polypeptide=Lus10017202 locus=Lus10017202.g ID=Lus10017202.BGIv1.0 annot-version=v1.0
ATGTCAATGTATCACAACAGCTTCAAACCTCACCATGGCCGCCGCCCTCACCACAATCCCTACAGCAACAATTTCCACCCTTACGAAGAATTCAACCCCT
TCCCACAATTCGGATCCGCCGCCTTCCCTCCGTTTCCGCCGCCAATGTTCCACAACATGTTCCCACACCACGAATTTGCGGCGGCGGCAAATCGTCCACG
CTCCGCCGTCGACTGGCACGAGACCCACGACGCGCACGTGATGACGGCCAAGCTACCCGGGTACAGAAAGGAGGAAGTGAAGCTTGAGCTTGAGGAAGAA
GAGAGGCACGTGCTTCACCTGAGCTGCGAGAAGAAGTCCGATCACAAGGAAGAGAAATCGTCGTCGGCGGAGGATAATTACTACCACTCGGAGCGGAGCA
ACGGCGGCAGGTTTGTCCAGCGCGTGACGCTGCCGGAGAATTCGAATCCGGAAAATATAAAGGCTGAGCTGGAGCATGGAGTGCTGACCGTCACAATTCC
CAAGAAGAAGAAGGAGAGCAAGAAGAGAAGCTCGAGAATTATTCTCATCTCTTGA
AA sequence
>Lus10017202 pacid=23165830 polypeptide=Lus10017202 locus=Lus10017202.g ID=Lus10017202.BGIv1.0 annot-version=v1.0
MSMYHNSFKPHHGRRPHHNPYSNNFHPYEEFNPFPQFGSAAFPPFPPPMFHNMFPHHEFAAAANRPRSAVDWHETHDAHVMTAKLPGYRKEEVKLELEEE
ERHVLHLSCEKKSDHKEEKSSSAEDNYYHSERSNGGRFVQRVTLPENSNPENIKAELEHGVLTVTIPKKKKESKKRSSRIILIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G53540 HSP20-like chaperones superfam... Lus10017202 0 1
AT3G60720 PDLP8 plasmodesmata-located protein ... Lus10010362 1.0 0.9712
AT1G19715 Mannose-binding lectin superfa... Lus10024290 2.0 0.9617
AT3G10910 RING/U-box superfamily protein... Lus10029037 2.2 0.9494
AT4G27290 S-locus lectin protein kinase ... Lus10016862 3.0 0.9577
AT1G31335 unknown protein Lus10040642 3.7 0.9462
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Lus10009321 5.3 0.9507
AT4G27960 UBC9 ubiquitin conjugating enzyme 9... Lus10005072 5.7 0.9452
AT1G71890 SUC5, ATSUC5 SUCROSE-PROTON SYMPORTER 5, Ma... Lus10014821 5.7 0.9301
AT5G27690 Heavy metal transport/detoxifi... Lus10020906 6.5 0.9465
Lus10020401 7.5 0.9349

Lus10017202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.