Lus10017203 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59580 108 / 2e-28 UGT76E1 UDP-glucosyl transferase 76E1 (.1)
AT2G26480 108 / 2e-28 UGT76D1 UDP-glucosyl transferase 76D1 (.1)
AT3G11340 101 / 1e-25 UGT76B1 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1)
AT3G46660 100 / 3e-25 UGT76E12 UDP-glucosyl transferase 76E12 (.1)
AT5G59590 99 / 6e-25 UGT76E2 UDP-glucosyl transferase 76E2 (.1)
AT3G46680 97 / 4e-24 UDP-Glycosyltransferase superfamily protein (.1)
AT3G46700 97 / 4e-24 UDP-Glycosyltransferase superfamily protein (.1)
AT5G05860 97 / 5e-24 UGT76C2 UDP-glucosyl transferase 76C2 (.1)
AT5G05870 96 / 8e-24 UGT76C1 UDP-glucosyl transferase 76C1 (.1)
AT1G22360 94 / 5e-23 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017201 184 / 1e-56 AT1G22380 337 / 4e-111 UDP-glucosyl transferase 85A3 (.1)
Lus10009876 118 / 1e-31 AT1G22380 295 / 2e-94 UDP-glucosyl transferase 85A3 (.1)
Lus10004670 115 / 2e-30 AT1G22340 313 / 1e-101 UDP-glucosyl transferase 85A7 (.1)
Lus10014831 107 / 2e-27 AT1G22380 296 / 5e-95 UDP-glucosyl transferase 85A3 (.1)
Lus10004673 100 / 5e-27 AT3G11340 236 / 1e-76 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10041055 104 / 1e-26 AT1G22360 610 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Lus10013925 103 / 3e-26 AT1G22380 560 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Lus10013924 103 / 3e-26 AT1G22400 551 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10004671 102 / 6e-26 AT3G55700 450 / 4e-156 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G105400 177 / 5e-54 AT1G22380 324 / 6e-106 UDP-glucosyl transferase 85A3 (.1)
Potri.016G105300 176 / 1e-53 AT1G22380 327 / 8e-107 UDP-glucosyl transferase 85A3 (.1)
Potri.008G062400 144 / 2e-41 AT1G22380 344 / 8e-114 UDP-glucosyl transferase 85A3 (.1)
Potri.006G022300 110 / 1e-28 AT1G22360 518 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.001G245900 108 / 3e-28 AT3G46660 452 / 7e-157 UDP-glucosyl transferase 76E12 (.1)
Potri.006G023151 106 / 2e-27 AT1G22400 521 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.001G313000 105 / 4e-27 AT1G22360 564 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.006G023700 105 / 6e-27 AT1G22370 476 / 2e-165 UDP-glucosyl transferase 85A5 (.1.2)
Potri.016G021000 104 / 7e-27 AT1G22360 561 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.016G021300 103 / 2e-26 AT1G22400 522 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Lus10017203 pacid=23165822 polypeptide=Lus10017203 locus=Lus10017203.g ID=Lus10017203.BGIv1.0 annot-version=v1.0
ATGTCTGGCAAACCTTTCCTGTGGGTGATACGGCGGGATTCGGTGTCCGGGCTTACCGATTCGAGCCGGGCCTTGTTGGCTAGTCTTGGAGGAACGACGG
CGCGTGATGGTTCGTGTCTGATAGTGGACTGGGCCCCGCAGTTGGAAGTGCTGGCCCATCCAGCGGTGGGTGGGTTTTTCAGTCACGGTTGTTGGAACTC
AGTGATGGTGTGCTGGCCCAAACTTGCCGACCAGCAAGTTAATAGTAGGGTGGTCAGTCACGTCTGGGGGAATGGGTTTGATATGAAGGACACGTGTGAC
CGAGCAACGGTGGAGAAATTGGTCAGAGACTTGATAGATGACAGTCATGACGGTGAGATAGTGAAATCGACAGAGAAAGTTGCGAGGATGGCCAGAAATG
GTATAAAGGAAGGTGGTCCTTCTTATGGTAATTTGAAGAGGCTGGTGAAGGATATCCAGTCAATGAACAAAAACAAGAGCTGA
AA sequence
>Lus10017203 pacid=23165822 polypeptide=Lus10017203 locus=Lus10017203.g ID=Lus10017203.BGIv1.0 annot-version=v1.0
MSGKPFLWVIRRDSVSGLTDSSRALLASLGGTTARDGSCLIVDWAPQLEVLAHPAVGGFFSHGCWNSVMVCWPKLADQQVNSRVVSHVWGNGFDMKDTCD
RATVEKLVRDLIDDSHDGEIVKSTEKVARMARNGIKEGGPSYGNLKRLVKDIQSMNKNKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G26480 UGT76D1 UDP-glucosyl transferase 76D1 ... Lus10017203 0 1
Lus10035428 1.0 0.9012
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Lus10029135 6.7 0.7505
AT4G35260 IDH-I, IDH1 isocitrate dehydrogenase I, is... Lus10014436 7.1 0.8118
Lus10020988 7.9 0.7213
AT1G28300 B3 LEC2 LEAFY COTYLEDON 2, AP2/B3-like... Lus10015428 8.7 0.8118
Lus10033071 10.0 0.8118
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Lus10037631 10.5 0.6012
Lus10003695 11.2 0.8118
Lus10003774 12.2 0.8118
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10005596 13.2 0.8118

Lus10017203 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.