Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59030 90 / 3e-24 COPT1 copper transporter 1 (.1) AT2G26975 85 / 2e-22 Ctr copper transporter family (.1) AT3G46900 85 / 3e-22 COPT2 copper transporter 2 (.1) AT2G37925 82 / 3e-21 COPT4 copper transporter 4 (.1) AT5G59040 69 / 5e-16 COPT3 copper transporter 3 (.1) AT5G20650 45 / 4e-07 COPT5 copper transporter 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021108 [exp] 176 / 4e-58 AT2G37925 120 / 2e-35 copper transporter 4 (.1) Lus10040726 [exp] 102 / 5e-29 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1) Lus10016464 [exp] 95 / 4e-26 AT5G59030 151 / 1e-47 copper transporter 1 (.1) Lus10016462 [exp] 68 / 1e-16 AT5G59030 76 / 3e-19 copper transporter 1 (.1) Lus10017205 [exp] 58 / 5e-12 AT2G26975 87 / 2e-22 Ctr copper transporter family (.1) Lus10021107 [exp] 58 / 7e-12 AT5G59040 87 / 1e-22 copper transporter 3 (.1) Lus10016463 [exp] 52 / 7e-10 AT2G26975 92 / 5e-25 Ctr copper transporter family (.1) Lus10023045 [exp] 52 / 9e-10 AT2G26975 84 / 2e-21 Ctr copper transporter family (.1) Lus10032428 [exp] 48 / 4e-08 AT2G26975 87 / 1e-22 Ctr copper transporter family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G038700 [exp] 108 / 2e-31 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1) Potri.006G093300 [exp] 107 / 5e-31 AT2G37925 114 / 3e-33 copper transporter 4 (.1) Potri.009G038800 [exp] 106 / 1e-30 AT5G59030 148 / 4e-46 copper transporter 1 (.1) Potri.001G246000 [exp] 98 / 2e-27 AT5G59030 134 / 9e-41 copper transporter 1 (.1) Potri.006G093200 [exp] 68 / 9e-16 AT3G46900 89 / 6e-23 copper transporter 2 (.1) Potri.006G219200 [exp] 49 / 2e-08 AT5G20650 140 / 1e-43 copper transporter 5 (.1) Potri.006G140700 [exp] 46 / 2e-07 AT5G20650 151 / 7e-48 copper transporter 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04145 [flax] [poplar] Ctr Ctr copper transporter family
Representative CDS sequence Show only first row Show all	>Lus10017204 pacid=23165754 polypeptide=Lus10017204 locus=Lus10017204.g ID=Lus10017204.BGIv1.0 annot-version=v1.0 ATGTACGCCTGCGCGCTGATGTTCGTTTTCGAAGTGGCGGTTGCGGTGGAGTGGCTGAGCTACCGCAGCATCGTGAAGCCCGGGACGAGTAGAGTCGCCG CCGGGGTCTTCAAGACCGGGATGTTCGCCGTGCGTGCGGGTCTGTCGTATATGGTTATGCTGTCGGTTATGTCGTACAACGGCGGCGTTTTCATCGTGGC TGTGTTGGGCCACGCCGTGGGGTTTGTTCTGTGTGGGAGCTCGGTGTTGCGGAAGTCCGACAAGGCGCCGGATCTTCCCCAGCCCAAATGCTGA
AA sequence Show only first row Show all	>Lus10017204 pacid=23165754 polypeptide=Lus10017204 locus=Lus10017204.g ID=Lus10017204.BGIv1.0 annot-version=v1.0 MYACALMFVFEVAVAVEWLSYRSIVKPGTSRVAAGVFKTGMFAVRAGLSYMVMLSVMSYNGGVFIVAVLGHAVGFVLCGSSVLRKSDKAPDLPQPKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59030		COPT1	copper transporter 1 (.1)		Lus10017204 [exp]	0	1
AT2G37925		COPT4	copper transporter 4 (.1)		Lus10021108 [exp]	1.7	0.9271
AT3G05327			Cyclin family protein (.1)		Lus10029933 [exp]	4.4	0.8926
AT1G13920			Remorin family protein (.1)		Lus10037111 [exp]	6.6	0.9215
AT5G08391			Protein of unknown function (D...		Lus10032032 [exp]	6.6	0.8889
AT4G05220			Late embryogenesis abundant (L...		Lus10006755 [exp]	6.7	0.9115
AT2G42820		HVA22F	HVA22-like protein F (.1)		Lus10031386 [exp]	7.9	0.9202
AT1G54400			HSP20-like chaperones superfam...		Lus10032902 [exp]	11.5	0.9181
AT1G13920			Remorin family protein (.1)		Lus10036964 [exp]	13.4	0.8968
AT5G19875			unknown protein		Lus10034527 [exp]	14.7	0.8944
AT2G15310		ATARFB1A	ADP-ribosylation factor B1A (....		Lus10002817 [exp]	15.8	0.8873

Compare expression of checked genes

Lus10017204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.