Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G03270 171 / 3e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G17020 166 / 3e-53 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G09740 73 / 2e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 71 / 2e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G11930 69 / 5e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G11360 68 / 2e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G62550 67 / 2e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G54430 62 / 4e-12 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT4G27320 56 / 6e-10 ATPHOS34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021104 [exp] 322 / 7e-115 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10022602 [exp] 288 / 2e-101 AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021501 [exp] 196 / 2e-65 AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10037761 [exp] 161 / 3e-51 AT3G17020 224 / 4e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10016900 [exp] 167 / 2e-49 AT3G17020 229 / 1e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 67 / 3e-14 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 63 / 5e-13 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 63 / 6e-13 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 62 / 5e-12 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G092700 [exp] 231 / 4e-79 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.016G104600 [exp] 227 / 2e-77 AT3G53990 229 / 6e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.017G144301 [exp] 182 / 8e-60 AT3G03270 248 / 9e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.004G075375 [exp] 177 / 1e-57 AT3G03270 243 / 9e-84 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G144100 [exp] 176 / 6e-57 AT3G17020 234 / 3e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G104700 [exp] 74 / 6e-17 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 74 / 1e-16 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 68 / 2e-14 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.002G196700 [exp] 66 / 7e-14 AT3G62550 196 / 6e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.011G039800 [exp] 66 / 3e-13 AT1G11360 269 / 3e-91 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10017207 pacid=23165796 polypeptide=Lus10017207 locus=Lus10017207.g ID=Lus10017207.BGIv1.0 annot-version=v1.0 ATGGGGAAAGACAAGACGATCGGAATAGCAATGGACTTCTCCGCCAGCAGCAAGAACGCCCTCAAATGGGCTCTCGACAACTTGGCTGACAAAGGCGACA CCGTCTACATCATCCATGTCCACCCCCATGAACTCCCCGAGGGCAAACAGCAACTCTGGGGCAAAGCCGGCTCTCCTTTGATTCCGCTGTCTGAGTTCAG AGAGCCTGAAGTGATGAAAAGCTACGACCTGAAGCCCGATGCTGAGGTTCTCGATTTGCTCGACACTGCCACCAAGCAGAAAGAGATCAAAATTGTGGCG AAGCTTTACTGGGGAGGAGATGCGAGAGACAAGATCATTGACGCCATAGACGGACTGAAGCTGGACTCGATCGTCATGGGAAGCAGAGGGCTTGGAACTG TTAAGAGGATATTGATGGGGAGCGTGAGCTCGTATGTGATGAACACGGCTTCAATCCCAGTCACCATTGTGAAGGATAAGCACTGA
AA sequence Show only first row Show all	>Lus10017207 pacid=23165796 polypeptide=Lus10017207 locus=Lus10017207.g ID=Lus10017207.BGIv1.0 annot-version=v1.0 MGKDKTIGIAMDFSASSKNALKWALDNLADKGDTVYIIHVHPHELPEGKQQLWGKAGSPLIPLSEFREPEVMKSYDLKPDAEVLDLLDTATKQKEIKIVA KLYWGGDARDKIIDAIDGLKLDSIVMGSRGLGTVKRILMGSVSSYVMNTASIPVTIVKDKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53990			Adenine nucleotide alpha hydro...		Lus10017207 [exp]	0	1
AT2G03270			DNA-binding protein, putative ...		Lus10026309 [exp]	5.1	0.9271
AT1G47530			MATE efflux family protein (.1...		Lus10042130 [exp]	5.5	0.9402
AT4G27290			S-locus lectin protein kinase ...		Lus10038552 [exp]	5.7	0.9456
AT4G33950		ATOST1, P44, SR...	SNF1-RELATED PROTEIN KINASE 2....		Lus10004382 [exp]	6.7	0.9309
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10014922 [exp]	7.7	0.9174
AT2G14440			Leucine-rich repeat protein ki...		Lus10041860 [exp]	8.2	0.9401
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10033743 [exp]	8.4	0.9441
AT5G65380			MATE efflux family protein (.1...		Lus10002645 [exp]	10.0	0.9385
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10027585 [exp]	10.6	0.9323
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Lus10010476 [exp]	12.1	0.8657

Compare expression of checked genes

Lus10017207 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.