Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021100 [exp] 129 / 7e-41 ND / Lus10022600 [exp] 92 / 4e-26 ND / Lus10021499 [exp] 89 / 5e-25 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G092300 [exp] 62 / 2e-14 ND / Potri.016G103900 [exp] 61 / 8e-14 ND / Potri.010G196500 [exp] 50 / 8e-10 ND / Potri.008G061600 [exp] 46 / 1e-07 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017210 pacid=23165742 polypeptide=Lus10017210 locus=Lus10017210.g ID=Lus10017210.BGIv1.0 annot-version=v1.0 ATGGCGGCGAATCTTCGGATCTCTCATCTCCTCCTCCTATTACTTACCCTCTCCGCAACAACAAACAACTCAAGATCCGCAGAGGCCAGAACACTCCCTT TCTCATCACTTCACCTCGGATCTTCCAAGATTTTTGCAACGCTGGGAGTGGTATGCAAGTGTTGTGATAATAAACAGTCTGAAACTAACGGTGAATGTTC CAGCTCCTGGGAAAAAGGGTCTTGTCGCGATGTCCAGTGCCTTCCATGGAGAATCGGATAG
AA sequence Show only first row Show all	>Lus10017210 pacid=23165742 polypeptide=Lus10017210 locus=Lus10017210.g ID=Lus10017210.BGIv1.0 annot-version=v1.0 MAANLRISHLLLLLLTLSATTNNSRSAEARTLPFSSLHLGSSKIFATLGVVCKCCDNKQSETNGECSSSWEKGSCRDVQCLPWRIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017210 [exp]	0	1
AT5G44250			Protein of unknown function DU...		Lus10021741 [exp]	2.4	0.9462
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Lus10009376 [exp]	3.5	0.9492
AT4G05530		SDRA, IBR1	SHORT-CHAIN DEHYDROGENASE/REDU...		Lus10020019 [exp]	5.3	0.9295
AT5G11950		LOG8	LONELY GUY 8, Putative lysine ...		Lus10026131 [exp]	8.0	0.9388
AT5G61820			unknown protein		Lus10017316 [exp]	12.0	0.9429
AT1G10650			SBP (S-ribonuclease binding pr...		Lus10030891 [exp]	16.4	0.9299
AT2G36950			Heavy metal transport/detoxifi...		Lus10022617 [exp]	16.6	0.9429
AT4G35110			Arabidopsis phospholipase-like...		Lus10026277 [exp]	17.8	0.9406
AT5G23810		AAP7	amino acid permease 7 (.1.2)		Lus10010580 [exp]	19.0	0.9426
AT4G29890			choline monooxygenase, putativ...		Lus10008571 [exp]	21.2	0.9339

Compare expression of checked genes

Lus10017210 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.