Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18420 107 / 3e-32 Gibberellin-regulated family protein (.1) AT1G75750 106 / 1e-31 GASA1 GAST1 protein homolog 1 (.1.2) AT4G09600 91 / 2e-25 GASA3 GAST1 protein homolog 3 (.1) AT1G22690 84 / 1e-22 Gibberellin-regulated family protein (.1.2.3) AT5G14920 74 / 3e-17 Gibberellin-regulated family protein (.1.2) AT4G09610 69 / 1e-16 GASA2 GAST1 protein homolog 2 (.1) AT5G59845 59 / 8e-13 Gibberellin-regulated family protein (.1) AT1G74670 57 / 2e-12 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT2G39540 57 / 3e-12 Gibberellin-regulated family protein (.1) AT1G10588 57 / 4e-12 Gibberellin-regulated family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021098 [exp] 103 / 3e-30 AT2G18420 77 / 8e-20 Gibberellin-regulated family protein (.1) Lus10025962 [exp] 91 / 4e-25 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1) Lus10024338 [exp] 86 / 3e-23 ND 78 / 3e-20 Lus10034524 [exp] 84 / 1e-22 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2) Lus10009421 [exp] 84 / 1e-21 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3) Lus10033145 [exp] 79 / 9e-21 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2) Lus10014262 [exp] 79 / 2e-20 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1) Lus10039443 [exp] 70 / 2e-16 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2) Lus10029340 [exp] 58 / 1e-12 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G239100 [exp] 117 / 4e-36 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2) Potri.002G022500 [exp] 117 / 1e-35 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.005G239000 [exp] 111 / 2e-33 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1) Potri.002G022600 [exp] 108 / 1e-32 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2) Potri.002G022700 [exp] 97 / 9e-28 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2) Potri.013G113400 [exp] 92 / 7e-26 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.012G076700 [exp] 90 / 5e-25 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1) Potri.015G071500 [exp] 87 / 8e-24 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2) Potri.019G083900 [exp] 81 / 3e-21 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3) Potri.001G350600 [exp] 69 / 2e-15 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10017212 pacid=23165782 polypeptide=Lus10017212 locus=Lus10017212.g ID=Lus10017212.BGIv1.0 annot-version=v1.0 ATGGCTTCCCTTATCCTCTCCCTCGTCGTCCTCCAGCTTACTCATGCTGCTGCTGCTGATAACTACCCCAGTACTCCGACCATCGATTGTAAGGGGGCAT GCAAGGCGAGGTGTCAGCTGTCGAGCAGGCCAAACCTGTGCCACAGGGCTTGTGGAACTTGCTGCAAAAGATGCAGCTGCGTCCCTCCCGGCACCGCCGG CAACTATGACAAGTGTGCTTGCTACGCCTCTTTGACCACCCACGGCGGCCGCCGCAAGTGCCCTTAA
AA sequence Show only first row Show all	>Lus10017212 pacid=23165782 polypeptide=Lus10017212 locus=Lus10017212.g ID=Lus10017212.BGIv1.0 annot-version=v1.0 MASLILSLVVLQLTHAAAADNYPSTPTIDCKGACKARCQLSSRPNLCHRACGTCCKRCSCVPPGTAGNYDKCACYASLTTHGGRRKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75750		GASA1	GAST1 protein homolog 1 (.1.2)		Lus10017212 [exp]	0	1
AT1G15000		SCPL50	serine carboxypeptidase-like 5...		Lus10041000 [exp]	7.1	0.9552
AT2G23770			protein kinase family protein ...		Lus10000577 [exp]	7.5	0.9603
AT1G62300	WRKY	ATWRKY6, WRKY6	WRKY family transcription fact...		Lus10030040 [exp]	11.8	0.9448
AT5G65380			MATE efflux family protein (.1...		Lus10012741 [exp]	13.7	0.9496
AT4G15093			catalytic LigB subunit of arom...		Lus10034361 [exp]	14.9	0.9530
AT3G06490	MYB	BOS1, AtMYB108	BOTRYTIS-SUSCEPTIBLE1, myb dom...		Lus10037818 [exp]	19.4	0.9460
AT1G15530			Concanavalin A-like lectin pro...		Lus10019879 [exp]	20.4	0.9449
AT4G01250	WRKY	ATWRKY22, WRKY2...	WRKY family transcription fact...		Lus10032303 [exp]	25.5	0.9438
AT5G20900	ZIM	TIFY3B, JAZ12	jasmonate-zim-domain protein 1...		Lus10027639 [exp]	27.8	0.9048
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10009137 [exp]	29.0	0.9481

Compare expression of checked genes

Lus10017212 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.