Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16950 38 / 8e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026852 [exp] 0 / 1 AT5G16950 104 / 8e-31 unknown protein Lus10021093 [exp] 0 / 1 AT5G16950 106 / 2e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G082000 [exp] 87 / 5e-24 AT5G16950 91 / 2e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017219 pacid=23165786 polypeptide=Lus10017219 locus=Lus10017219.g ID=Lus10017219.BGIv1.0 annot-version=v1.0 ATGGGATCTGAAGAGCAGAAGGATCCATTGAAAGGGGTGGATTGGAAAGCAATAGGCACTGAGCTTCAAAAGGACGCAAGTGCTGGCACAAAACAAGTAG TTAAGAAGCGGCTTCCGAAAAGGAGCAGGCAGATTCCTGAAAGCTATTTCCTTCCACGAATCCGTATTTGCCTGGCCCTCTGCCATCGGCTTCTATGGTG CTTGTATAGCTGGTGGGATTGGGGCTGGCATGCTGGTGGAGATGTGGATTAA
AA sequence Show only first row Show all	>Lus10017219 pacid=23165786 polypeptide=Lus10017219 locus=Lus10017219.g ID=Lus10017219.BGIv1.0 annot-version=v1.0 MGSEEQKDPLKGVDWKAIGTELQKDASAGTKQVVKKRLPKRSRQIPESYFLPRIRICLALCHRLLWCLYSWWDWGWHAGGDVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017219 [exp]	0	1
AT1G26930			Galactose oxidase/kelch repeat...		Lus10024239 [exp]	1.7	0.8896
AT2G39260			binding;RNA binding (.1)		Lus10030801 [exp]	2.8	0.8895
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011717 [exp]	5.3	0.8822
AT1G66980		GDPDL2, SNC4	Glycerophosphodiester phosphod...		Lus10027085 [exp]	5.7	0.8507
AT1G11760		MED32	unknown protein		Lus10030983 [exp]	6.0	0.8504
AT1G72890			Disease resistance protein (TI...		Lus10009384 [exp]	6.9	0.8419
AT5G17680			disease resistance protein (TI...		Lus10010221 [exp]	8.5	0.8845
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	8.9	0.8574
AT5G55500		ATXYLT	"beta-1,2-xylosyltransferase",...		Lus10014902 [exp]	8.9	0.8560
AT2G32760			unknown protein		Lus10022575 [exp]	10.1	0.8124

Compare expression of checked genes

Lus10017219 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.