Lus10017220 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G76970 100 / 1e-25 Target of Myb protein 1 (.1)
AT1G21380 98 / 1e-24 Target of Myb protein 1 (.1)
AT4G32760 70 / 1e-14 ENTH/VHS/GAT family protein (.1.2)
AT3G08790 69 / 3e-14 ENTH/VHS/GAT family protein (.1)
AT2G38410 62 / 6e-12 ENTH/VHS/GAT family protein (.1)
AT5G01760 62 / 7e-12 ENTH/VHS/GAT family protein (.1)
AT5G63640 53 / 6e-09 ENTH/VHS/GAT family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028649 173 / 2e-51 AT1G21380 452 / 7e-152 Target of Myb protein 1 (.1)
Lus10018948 157 / 3e-47 AT1G21380 439 / 1e-151 Target of Myb protein 1 (.1)
Lus10029739 112 / 1e-29 AT1G21380 518 / 0.0 Target of Myb protein 1 (.1)
Lus10042770 111 / 2e-29 AT1G21380 514 / 4e-180 Target of Myb protein 1 (.1)
Lus10022140 87 / 1e-20 AT4G32760 637 / 0.0 ENTH/VHS/GAT family protein (.1.2)
Lus10025264 62 / 7e-12 AT2G38410 406 / 1e-132 ENTH/VHS/GAT family protein (.1)
Lus10009082 62 / 1e-11 AT5G05570 358 / 6e-106 transducin family protein / WD-40 repeat family protein (.1.2)
Lus10022753 60 / 4e-11 AT5G01760 434 / 3e-144 ENTH/VHS/GAT family protein (.1)
Lus10014155 60 / 5e-11 AT5G01760 439 / 5e-146 ENTH/VHS/GAT family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G184900 117 / 1e-31 AT1G21380 473 / 2e-163 Target of Myb protein 1 (.1)
Potri.002G075500 110 / 5e-29 AT1G21380 471 / 2e-162 Target of Myb protein 1 (.1)
Potri.006G241000 82 / 9e-19 AT4G32760 630 / 0.0 ENTH/VHS/GAT family protein (.1.2)
Potri.018G039100 81 / 1e-18 AT4G32760 561 / 0.0 ENTH/VHS/GAT family protein (.1.2)
Potri.006G106500 62 / 6e-12 AT2G38410 407 / 2e-133 ENTH/VHS/GAT family protein (.1)
Potri.016G131900 61 / 1e-11 AT2G38410 406 / 2e-132 ENTH/VHS/GAT family protein (.1)
Potri.T005401 55 / 2e-09 AT5G63640 449 / 1e-156 ENTH/VHS/GAT family protein (.1)
Potri.T010700 55 / 2e-09 AT5G63640 449 / 1e-156 ENTH/VHS/GAT family protein (.1)
Potri.004G138600 43 / 2e-05 AT5G63640 447 / 1e-155 ENTH/VHS/GAT family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03127 GAT GAT domain
Representative CDS sequence
>Lus10017220 pacid=23165775 polypeptide=Lus10017220 locus=Lus10017220.g ID=Lus10017220.BGIv1.0 annot-version=v1.0
ATGGAAATTCTCGGTGCCTTGGATCCTAAGAAACCTGAGGGTTTGAATGAAGAGGTGATTGTAGACCTTGTTGATCAATGCCGTTCATATCAAACAAGGG
TTAGCGATCAATGCCGTTTATATCAAACAAGGGTTAGGCTTCTTGTAGATGAGGAACTTCTAGCACAAGGATTATCCCTCAACGATACCTTGCAGCGTGT
CATTCGTCGCCATGATGACATCGCTAATGGAACTGCTGCTGCTCAAGTGGTAGAGACGCAACGAGAGACTCCACTCGTGCCGCTTGTTAATGTTAACCAT
GCGGAGGATGATGATGAATCAGATGATGATCTCTCCCAGCTGGCTCGTATATTAGTTACTGCATCTACTTGTTTTTATGATCCATTTCGAAGAGAACTTG
TTCTTACTAACCTTAAGTGA
AA sequence
>Lus10017220 pacid=23165775 polypeptide=Lus10017220 locus=Lus10017220.g ID=Lus10017220.BGIv1.0 annot-version=v1.0
MEILGALDPKKPEGLNEEVIVDLVDQCRSYQTRVSDQCRLYQTRVRLLVDEELLAQGLSLNDTLQRVIRRHDDIANGTAAAQVVETQRETPLVPLVNVNH
AEDDDESDDDLSQLARILVTASTCFYDPFRRELVLTNLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G76970 Target of Myb protein 1 (.1) Lus10017220 0 1
AT2G30690 Protein of unknown function, D... Lus10014743 3.5 0.7889
AT5G55500 ATXYLT "beta-1,2-xylosyltransferase",... Lus10014902 3.7 0.8275
AT3G03980 NAD(P)-binding Rossmann-fold s... Lus10002628 6.3 0.8150
AT5G25820 Exostosin family protein (.1) Lus10023927 6.9 0.8082
AT5G62810 ATPEX14, PED2, ... PEROXISOME DEFECTIVE 2, peroxi... Lus10039935 7.7 0.8112
AT2G47790 Transducin/WD40 repeat-like su... Lus10003441 9.2 0.7915
AT1G19835 Plant protein of unknown funct... Lus10032386 14.1 0.7868
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10011716 15.7 0.7885
AT1G15060 Uncharacterised conserved prot... Lus10000099 20.8 0.7243
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Lus10006596 21.4 0.7664

Lus10017220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.