Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55210 116 / 1e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT5G49040 113 / 2e-31 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 111 / 7e-31 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 107 / 4e-29 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 106 / 5e-29 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 104 / 3e-28 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 103 / 7e-28 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49030 108 / 3e-27 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3) AT3G13662 95 / 1e-24 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G38700 94 / 5e-24 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021082 [exp] 317 / 1e-111 AT5G49040 120 / 2e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 115 / 4e-32 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 114 / 7e-32 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10026176 [exp] 110 / 2e-30 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 110 / 3e-30 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 109 / 4e-30 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021083 [exp] 109 / 7e-30 AT1G22900 150 / 5e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10032939 [exp] 99 / 9e-26 AT5G42500 139 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10039561 [exp] 96 / 1e-24 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G195300 [exp] 124 / 5e-36 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 124 / 1e-35 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 123 / 3e-35 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216400 [exp] 120 / 5e-34 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023800 [exp] 118 / 1e-33 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G061000 [exp] 117 / 6e-33 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 115 / 2e-32 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216300 [exp] 112 / 3e-31 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.003G216200 [exp] 101 / 5e-27 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.001G009100 [exp] 99 / 6e-26 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10017228 pacid=23165852 polypeptide=Lus10017228 locus=Lus10017228.g ID=Lus10017228.BGIv1.0 annot-version=v1.0 ATGGCCAAGATCACCATCACAACCCTCCTCCTCCTCCTCCTCCTTTCATCCACATCCTTCTCCTCCGCCGCTGCGAAAAAACCCACCTCCTCCGGCGACG ACAATAGCTTCGCCACGAAGCTCTCCCGCGAAGAGTTCGGCCTCGACAAGGAAGAGAAGCTCACGCGCCTCCACTTCTACATGAGCGACTTCTTCGGTGG CGAGAACGCCACCGCCATCCCCGTCACCAACGTCCTCGACAACAACACCTTCTACGGCGGCATTTACTTGGCCGACGACTCCTTGACATTGGGACCCGAG CTGAACTCCACTTCGGTCGGGACGGGCAGGGGTTTCTACAGCTTCCCTTCCCCAAACGACTTCGTTTTGGAGATGGTCTACAACTTGGCGTTCACCCACG GCGCGTATAATGGGAGCACGTTGACCCTCGTGGGGCCCATTCACCCACGATCGATAAAGAACGAGCTGTCGATCGTGGGCGGGACTGGGGATTTCCGGTT CAGTCGTGGATACGCCGTCGCTAAAAGGATCGTGCTCGATTTTCAAGCTCTGCTCGTTGTGAGGGAGCTTGACGTTTATGTTTCACATTATTAA
AA sequence Show only first row Show all	>Lus10017228 pacid=23165852 polypeptide=Lus10017228 locus=Lus10017228.g ID=Lus10017228.BGIv1.0 annot-version=v1.0 MAKITITTLLLLLLLSSTSFSSAAAKKPTSSGDDNSFATKLSREEFGLDKEEKLTRLHFYMSDFFGGENATAIPVTNVLDNNTFYGGIYLADDSLTLGPE LNSTSVGTGRGFYSFPSPNDFVLEMVYNLAFTHGAYNGSTLTLVGPIHPRSIKNELSIVGGTGDFRFSRGYAVAKRIVLDFQALLVVRELDVYVSHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55210			Disease resistance-responsive ...		Lus10017228 [exp]	0	1
AT5G49040			Disease resistance-responsive ...		Lus10021082 [exp]	2.0	0.9577
AT1G72230			Cupredoxin superfamily protein...		Lus10027043 [exp]	2.4	0.9569
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10024626 [exp]	3.2	0.9632
AT4G30170			Peroxidase family protein (.1)		Lus10001442 [exp]	4.5	0.9551
AT1G52800			2-oxoglutarate (2OG) and Fe(II...		Lus10008097 [exp]	4.5	0.9445
AT3G01190			Peroxidase superfamily protein...		Lus10018374 [exp]	5.5	0.9381
					Lus10041915 [exp]	6.0	0.9368
AT2G19070		SHT	spermidine hydroxycinnamoyl tr...		Lus10001282 [exp]	6.9	0.9455
AT1G61240			Protein of unknown function (D...		Lus10011228 [exp]	8.7	0.9069
AT1G61050			alpha 1,4-glycosyltransferase ...		Lus10011206 [exp]	9.0	0.9445

Compare expression of checked genes

Lus10017228 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.