Lus10017231 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58170 188 / 3e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 180 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT5G42500 176 / 1e-56 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 175 / 5e-56 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 173 / 2e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 168 / 2e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 168 / 3e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 160 / 2e-50 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 150 / 2e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13660 146 / 2e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029306 223 / 1e-74 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 196 / 6e-64 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 190 / 7e-62 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021084 173 / 4e-55 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10039561 166 / 1e-52 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10030483 156 / 2e-48 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10016237 153 / 3e-48 AT1G58170 149 / 6e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021083 155 / 7e-48 AT1G22900 150 / 5e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 150 / 2e-46 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G195300 239 / 2e-81 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 232 / 3e-78 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 228 / 9e-77 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 223 / 7e-75 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 206 / 2e-68 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 206 / 5e-68 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216400 200 / 1e-65 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 194 / 2e-63 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.016G060801 186 / 2e-60 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G131000 177 / 5e-57 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10017231 pacid=23165839 polypeptide=Lus10017231 locus=Lus10017231.g ID=Lus10017231.BGIv1.0 annot-version=v1.0
ATGGCCATCAAAGCCTTCCACGTCATCCTCCTCACCCTCCTCCTCCTCACAATCTCCCTAAACCCAAGTTTTTCCAAGATCATAAACCCTAAATTCGAAA
AACTCAGCCACCTCAAGTTCTACTTTCACGACATCGTCAGCGGGCCCAACCCGACTGCAGTCCCCGTGGTGGCGGCTCGGTCCGACTCGACCAATGCCAC
CAGCTCAGCATTCGGACTGGTGGTCATGATGGACAACCCTCTGACCGTGGGGCCCAACATGAGCTCCAAGATGGTGGGCCGGGCCCAGGGGATCTACGCA
GCTGCGTCGCGGAGCGAGCTTAGCTTTCTGATGGTGTTCAACTTTGCGTTTGGCGAAGGGAAGTACAACGGCAGCAATCTAAGCGTTTTGGGGAGGAACA
CCCCGTTTTCCGGCGTGAGGGAGATGCCGGTGGTCGGAGGGAGCGGGGTGTTCAAGTTTGCTAGAGGGTATGCTCAGGCGAAGACTCAACAGGTTGATTT
GCTGACCGGAGATGCTGTGGTTGAGTACAATGTCTATGTTTTCCATTACTGA
AA sequence
>Lus10017231 pacid=23165839 polypeptide=Lus10017231 locus=Lus10017231.g ID=Lus10017231.BGIv1.0 annot-version=v1.0
MAIKAFHVILLTLLLLTISLNPSFSKIINPKFEKLSHLKFYFHDIVSGPNPTAVPVVAARSDSTNATSSAFGLVVMMDNPLTVGPNMSSKMVGRAQGIYA
AASRSELSFLMVFNFAFGEGKYNGSNLSVLGRNTPFSGVREMPVVGGSGVFKFARGYAQAKTQQVDLLTGDAVVEYNVYVFHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G58170 Disease resistance-responsive ... Lus10017231 0 1
AT2G36780 UDP-Glycosyltransferase superf... Lus10027739 1.4 0.9421
AT4G22060 F-box family protein with a do... Lus10029350 3.6 0.8755
AT5G39190 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THA... Lus10035186 3.9 0.8990
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10032406 5.3 0.9043
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10042907 5.5 0.8838
AT3G23230 AP2_ERF ERF98 Integrase-type DNA-binding sup... Lus10011830 6.6 0.9401
AT3G18150 RNI-like superfamily protein (... Lus10042331 12.9 0.8323
AT4G12545 Bifunctional inhibitor/lipid-t... Lus10024624 13.2 0.8894
AT2G18470 AtPERK4, PERK4 proline-rich extensin-like rec... Lus10024020 13.3 0.8058
AT1G73990 SPPA1, SPPA signal peptide peptidase (.1) Lus10013333 15.0 0.8647

Lus10017231 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.