Lus10017232 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09690 280 / 4e-98 Translation protein SH3-like family protein (.1)
AT1G09590 280 / 4e-98 Translation protein SH3-like family protein (.1)
AT1G57860 275 / 4e-96 Translation protein SH3-like family protein (.1)
AT1G57660 275 / 4e-96 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021079 318 / 3e-113 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Lus10016241 303 / 3e-107 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10030882 300 / 4e-106 AT1G09690 296 / 2e-104 Translation protein SH3-like family protein (.1)
Lus10029302 300 / 4e-106 AT1G09690 294 / 1e-103 Translation protein SH3-like family protein (.1)
Lus10030607 298 / 2e-105 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G195400 289 / 1e-101 AT1G57860 305 / 5e-108 Translation protein SH3-like family protein (.1)
Potri.016G061100 287 / 7e-101 AT1G57860 305 / 7e-108 Translation protein SH3-like family protein (.1)
Potri.003G159500 284 / 9e-100 AT1G09690 305 / 4e-108 Translation protein SH3-like family protein (.1)
Potri.001G071100 282 / 5e-99 AT1G09690 307 / 7e-109 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01157 Ribosomal_L21e Ribosomal protein L21e
Representative CDS sequence
>Lus10017232 pacid=23165804 polypeptide=Lus10017232 locus=Lus10017232.g ID=Lus10017232.BGIv1.0 annot-version=v1.0
ATGCCGGCGGGTCACGGTCTTCGTTCTCGAACTCGAGATCTTTTCCAGAGAGGCTTCAGGAAGCGTGGTTACATTCCGTTGACGACTTACCTCCGTTCAT
ACAAGGTCGGTGACTACGTCGACGTCAAGGTCAATGGCGCCATTCACAAAGGTATGCCGCACAAGTTCTACCATGGACGCACCGGCCGCGTCTGGAACGT
CACCAAGCGCGCCATCGGCGTCGAGATGAACAAGCAGGTGAGGGGCAAGATCCTGAGGAAAAGGATCCACGTTAGGATTGAGCACGTCATCCCGTCAAGG
TGCACAGAGGAATTCCGTCTCAGGAAGAAGAAGAATGACGAACTGAAGGCCGCAGCAAAGGCCAAAGGTGAGAAGATCAGCACCAAGAGACAGCCTCAGG
GCCCTAAACCTGGTTTCATGGTGGGGGGTGCAACTCTTGAAACTGTTACACCTATTCCGTACGACGTCACCAACGATCTCAAGGGTGGATATTAG
AA sequence
>Lus10017232 pacid=23165804 polypeptide=Lus10017232 locus=Lus10017232.g ID=Lus10017232.BGIv1.0 annot-version=v1.0
MPAGHGLRSRTRDLFQRGFRKRGYIPLTTYLRSYKVGDYVDVKVNGAIHKGMPHKFYHGRTGRVWNVTKRAIGVEMNKQVRGKILRKRIHVRIEHVIPSR
CTEEFRLRKKKNDELKAAAKAKGEKISTKRQPQGPKPGFMVGGATLETVTPIPYDVTNDLKGGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09590 Translation protein SH3-like f... Lus10017232 0 1
AT3G05590 RPL18 ribosomal protein L18 (.1) Lus10015198 4.1 0.9652
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Lus10010429 5.8 0.9623
AT1G09690 Translation protein SH3-like f... Lus10029302 7.5 0.9528
AT2G02955 MEE12 maternal effect embryo arrest ... Lus10021646 8.2 0.9509
AT2G14860 Peroxisomal membrane 22 kDa (M... Lus10002118 8.5 0.9430
AT2G42740 RPL16A ribosomal protein large subuni... Lus10033607 8.7 0.9595
AT1G76010 Alba DNA/RNA-binding protein (... Lus10034549 8.9 0.9500
AT5G44500 Small nuclear ribonucleoprotei... Lus10013108 9.2 0.9585
AT1G74050 Ribosomal protein L6 family pr... Lus10039083 10.4 0.9614
AT3G53740 Ribosomal protein L36e family ... Lus10024402 12.0 0.9584

Lus10017232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.