Lus10017233 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48905 42 / 1e-06 LCR12 low-molecular-weight cysteine-rich 12 (.1)
AT2G22121 39 / 2e-05 LCR35 low-molecular-weight cysteine-rich 35 (.1)
AT4G29273 37 / 8e-05 LCR23 low-molecular-weight cysteine-rich 23 (.1)
AT4G29280 35 / 0.0006 LCR22 low-molecular-weight cysteine-rich 22 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021078 165 / 3e-55 AT5G48905 43 / 6e-07 low-molecular-weight cysteine-rich 12 (.1)
Lus10015984 38 / 6e-05 AT4G29280 47 / 1e-08 low-molecular-weight cysteine-rich 22 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G401800 43 / 8e-07 AT4G09153 43 / 5e-07 low-molecular-weight cysteine-rich 36 (.1)
Potri.006G195532 42 / 3e-06 AT4G29280 46 / 5e-08 low-molecular-weight cysteine-rich 22 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0054 Knottin_1 PF07333 SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence
>Lus10017233 pacid=23165808 polypeptide=Lus10017233 locus=Lus10017233.g ID=Lus10017233.BGIv1.0 annot-version=v1.0
ATGGCGAAGCATCAGCAATCAGTCCTCTTCATTCTCCTCCTCGTCTCAGTTGGAGTGATGGTAATGGCACCAAAGGCTGCAGAAGCGACGATAGGAGCAT
GTTCCATCGAGCTGAACCCGAACGGTTGCGCAATGCCAGGATGCCAGGAACGGTGCTTCCTCGACCACGGTGGTTGGGGACACTGCGCTCACGATACCGC
CACTGGTATCTTCCATTGCGTCTGCTTCTACTCTTGTCCTCGCCCCTGA
AA sequence
>Lus10017233 pacid=23165808 polypeptide=Lus10017233 locus=Lus10017233.g ID=Lus10017233.BGIv1.0 annot-version=v1.0
MAKHQQSVLFILLLVSVGVMVMAPKAAEATIGACSIELNPNGCAMPGCQERCFLDHGGWGHCAHDTATGIFHCVCFYSCPRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48905 LCR12 low-molecular-weight cysteine-... Lus10017233 0 1
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10019871 2.0 0.9069
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10014043 5.2 0.8889
AT3G03990 alpha/beta-Hydrolases superfam... Lus10017296 7.5 0.8482
AT1G23000 Heavy metal transport/detoxifi... Lus10028529 7.7 0.8468
AT3G15790 MBD11, ATMBD11 methyl-CPG-binding domain 11 (... Lus10002168 9.2 0.8716
AT5G01840 OFP AtOFP1 ARABIDOPSIS THALIANA OVATE FAM... Lus10042224 10.4 0.8522
Lus10011220 11.4 0.8934
Lus10018463 12.2 0.8724
AT2G27550 ATC centroradialis (.1) Lus10004884 14.1 0.8304
AT1G23000 Heavy metal transport/detoxifi... Lus10032445 15.7 0.8863

Lus10017233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.