Plant FIBer expression Database

Lus10017238 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G56700 43 / 1e-05 FBD / Leucine Rich Repeat domains containing protein (.1)
AT4G00160 39 / 0.0003 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT5G44980 39 / 0.0003 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT5G56690 39 / 0.0003 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT5G44960 39 / 0.0003 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT5G44940 38 / 0.0006 F-box/RNI-like superfamily protein (.1)
AT1G16930 38 / 0.0006 F-box/RNI-like/FBD-like domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF07723 LRR_2 Leucine Rich Repeat
Representative CDS sequence
>Lus10017238 pacid=23165780 polypeptide=Lus10017238 locus=Lus10017238.g ID=Lus10017238.BGIv1.0 annot-version=v1.0
ATGAATCTCAGGCTGAGATTGATATTGAGAATGCAACTGATTTTTCGTACCTTCCGAAATGTATGGTCTCTTTCGGAGAAAGCTCGACGGGGTTGTAGTA
GTAGTGAATGCTCCGTTGGTGTTTTACTTCCCAGTCTGAAGAAATTGCAGCTTTCGAGAGTGAAGACTACTGACGCCTCCCAGACACTAAGGAAGCTCCT
CTCTGGTTGCCCTGTTCTAGAGACTGCTCATCTAGTGAGAATTTTCGAAATTCGAGCACGACGATTGACAAAGACGACATGCTCGTTTGCTTCCGCACCA
TCCTTGAAGAGCCTGGCGATTATCGGCTGTGATGACGCCATTGGAATGGAAGCCCGCGCCTAG
AA sequence
>Lus10017238 pacid=23165780 polypeptide=Lus10017238 locus=Lus10017238.g ID=Lus10017238.BGIv1.0 annot-version=v1.0
MNLRLRLILRMQLIFRTFRNVWSLSEKARRGCSSSECSVGVLLPSLKKLQLSRVKTTDASQTLRKLLSGCPVLETAHLVRIFEIRARRLTKTTCSFASAP
SLKSLAIIGCDDAIGMEARA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G56700 FBD / Leucine Rich Repeat doma... Lus10017238
[exp]
0 1
AT3G51770 ATEOL1, ETO1 ARABIDOPSIS ETHYLENE OVERPRODU... Lus10010041
[exp]
7.3 0.7842
AT3G27700 C3HZnF zinc finger (CCCH-type) family... Lus10032140
[exp]
7.9 0.8205
AT5G47940 unknown protein Lus10016406
[exp]
12.2 0.8064
AT1G33060 NAC ANAC014 NAC 014 (.1.2) Lus10008240
[exp]
17.2 0.8273
AT4G39420 unknown protein Lus10014010
[exp]
45.4 0.7657
AT5G53150 DNAJ heat shock N-terminal dom... Lus10028842
[exp]
45.9 0.7677
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10041558
[exp]
49.4 0.7436
AT1G18790 AtRKD1, RKD1 RWP-RK domain containing 1, RW... Lus10034456
[exp]
50.0 0.7436
AT1G20480 AMP-dependent synthetase and l... Lus10011621
[exp]
50.5 0.7436
Lus10039545
[exp]
51.0 0.7436

Lus10017238 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.