Lus10017244 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06690 152 / 9e-47 WCRKC1 WCRKC thioredoxin 1 (.1.2)
AT5G04260 100 / 9e-27 WCRKC2 WCRKC thioredoxin 2 (.1)
AT4G03520 53 / 6e-09 ATHM2 Thioredoxin superfamily protein (.1.2)
AT1G03680 49 / 2e-07 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1)
AT3G15360 46 / 2e-06 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
AT1G50320 44 / 2e-05 ATHX, ATX thioredoxin X (.1)
AT1G19730 42 / 3e-05 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1)
AT1G45145 39 / 0.0002 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1)
AT5G39950 39 / 0.0003 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
AT1G69880 38 / 0.001 ATH8 thioredoxin H-type 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021067 249 / 3e-85 AT5G06690 215 / 3e-71 WCRKC thioredoxin 1 (.1.2)
Lus10038703 99 / 1e-25 AT5G04260 191 / 2e-61 WCRKC thioredoxin 2 (.1)
Lus10037975 73 / 5e-17 AT5G04260 149 / 3e-47 WCRKC thioredoxin 2 (.1)
Lus10013827 41 / 9e-05 AT3G53220 172 / 2e-56 Thioredoxin superfamily protein (.1)
Lus10039499 41 / 0.0001 AT3G06730 238 / 9e-81 thioredoxin putative plastidic, Thioredoxin z (.1)
Lus10036698 40 / 0.0001 AT1G69880 113 / 5e-33 thioredoxin H-type 8 (.1)
Lus10005258 40 / 0.0002 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Lus10030666 40 / 0.0002 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G059500 154 / 8e-48 AT5G06690 212 / 4e-70 WCRKC thioredoxin 1 (.1.2)
Potri.010G225701 104 / 3e-28 AT5G04260 204 / 3e-67 WCRKC thioredoxin 2 (.1)
Potri.008G036400 103 / 5e-28 AT5G04260 216 / 8e-72 WCRKC thioredoxin 2 (.1)
Potri.019G111200 45 / 3e-06 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2)
Potri.017G076700 44 / 1e-05 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Potri.006G123100 40 / 0.0002 AT3G53220 192 / 2e-64 Thioredoxin superfamily protein (.1)
Potri.001G028500 40 / 0.0003 AT3G06730 244 / 2e-83 thioredoxin putative plastidic, Thioredoxin z (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Lus10017244 pacid=23165759 polypeptide=Lus10017244 locus=Lus10017244.g ID=Lus10017244.BGIv1.0 annot-version=v1.0
ATGGCTGCAACTGCTGCTTTGACGACGGCGTGTTCTCCCATAATCTCCTCTCGAGAGTTCCACAGCAAATACCAACATCAACAACAACAGGGATTGACCA
GCTGCCCCCTCTTCAGCACCGCTTCCTCTTCTTCTTCTTTGTATTCTGGTAGAAGAAATAACAGCGAGCATTATCAGGGGAGGAAAGTTTCCGACTTTAG
AGCTTTCGGGTTCTGGCCCGATTTGAGATCCAAACCCACTTCCGTCGACATGGAACCCATCAACGATTCGGAGCAGCTGGATCAGATCCTGCTCCATGCT
AAGGAGCTCGCTCAACCTGTCGTCATTGACTGGATGGCGTCGTGGTGCAGGAAGTGCATATACTTAAAGCCGAAGCTAGAGAAATTAGCTGCCGAATTCG
ACAACAAAGCGAAGTTCTACTGCGTGGATGTGAACAAGGTGCCTCAGGCTCTGGTGAAGCGCGGCAACATATCTGTACGGTCGATAAGCTATTTGATGAA
ATGCCTCAATGTAAAGTTGTTATAA
AA sequence
>Lus10017244 pacid=23165759 polypeptide=Lus10017244 locus=Lus10017244.g ID=Lus10017244.BGIv1.0 annot-version=v1.0
MAATAALTTACSPIISSREFHSKYQHQQQQGLTSCPLFSTASSSSSLYSGRRNNSEHYQGRKVSDFRAFGFWPDLRSKPTSVDMEPINDSEQLDQILLHA
KELAQPVVIDWMASWCRKCIYLKPKLEKLAAEFDNKAKFYCVDVNKVPQALVKRGNISVRSISYLMKCLNVKLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06690 WCRKC1 WCRKC thioredoxin 1 (.1.2) Lus10017244 0 1
AT1G35420 alpha/beta-Hydrolases superfam... Lus10016930 2.0 0.9353
AT2G29670 Tetratricopeptide repeat (TPR)... Lus10005863 4.0 0.9257
AT1G08550 AVDE1, NPQ1 ARABIDOPSIS VIOLAXANTHIN DE-EP... Lus10042524 5.2 0.9338
AT2G46820 PSI-P, TMP14, P... THYLAKOID MEMBRANE PHOSPHOPROT... Lus10030191 5.7 0.9364
AT1G55370 NDF5 NDH-dependent cyclic electron ... Lus10002626 6.2 0.9036
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10041097 14.1 0.8452
AT3G27690 LHCB2.3, LHCB2:... LIGHT-HARVESTING CHLOROPHYLL B... Lus10001741 14.5 0.9070
AT2G39470 PnsL1, PPL2 Photosynthetic NDH subcomplex... Lus10023436 15.8 0.9256
AT4G12800 PSAL photosystem I subunit l (.1) Lus10002143 19.6 0.9203
AT5G13170 SAG29, SWEET15,... senescence-associated gene 29 ... Lus10040901 19.8 0.8127

Lus10017244 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.