Lus10017248 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G76060 157 / 2e-49 EMB1793 EMBRYO DEFECTIVE 1793, LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005621 258 / 2e-89 AT1G76060 202 / 2e-67 EMBRYO DEFECTIVE 1793, LYR family of Fe/S cluster biogenesis protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G016600 172 / 1e-55 AT1G76060 196 / 3e-65 EMBRYO DEFECTIVE 1793, LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0491 LYR-like PF05347 Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence
>Lus10017248 pacid=23165799 polypeptide=Lus10017248 locus=Lus10017248.g ID=Lus10017248.BGIv1.0 annot-version=v1.0
ATGACGACGACAATCAAGCTCCAGAAATGGAAGAATCTAGCGATCTCGGTCAACCATACAGTACGGAACAGCAGGGCTCTTAACTGGCGGCATATACACG
AAGGTCCGGACACATTGGAGGAGTTGTTCGAGAGGCATGTGGCGAAGAACAAAGAGACTACGTCGTCGCTAGACGAAGAAGAGGAAGAGCTACTGAACCG
GCGAAGGCTGACGAGCACGCGGCGAGAGGCGCTGCATCTGTACAGGGACATCTTGAGGGCGACGCGGTTCTTCGTGTGGCCAGACACTCGCGGGGTGATG
TGGAGGGACGTGCTAAGGGAGAACGCAAGGAAGGAGTTCGACGAAGCTCGGTTCGAGAAGGATCCGGAGATCGTGACGCGGCTTCTCATCAATGGCCGAG
ACGCCGTGGAATTTGCTCTGGAGAAGCTCGCCGAGAAGCAGAGGCTGCAAATTGAGAAAGAGCGCGGCGGAAATGGAGGATTCGGCCGCTGA
AA sequence
>Lus10017248 pacid=23165799 polypeptide=Lus10017248 locus=Lus10017248.g ID=Lus10017248.BGIv1.0 annot-version=v1.0
MTTTIKLQKWKNLAISVNHTVRNSRALNWRHIHEGPDTLEELFERHVAKNKETTSSLDEEEEELLNRRRLTSTRREALHLYRDILRATRFFVWPDTRGVM
WRDVLRENARKEFDEARFEKDPEIVTRLLINGRDAVEFALEKLAEKQRLQIEKERGGNGGFGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G76060 EMB1793 EMBRYO DEFECTIVE 1793, LYR fam... Lus10017248 0 1
AT5G03370 acylphosphatase family (.1) Lus10026533 5.3 0.8168
AT2G35900 unknown protein Lus10021249 8.4 0.8055
AT1G76060 EMB1793 EMBRYO DEFECTIVE 1793, LYR fam... Lus10005621 12.6 0.8035
AT3G03773 HSP20-like chaperones superfam... Lus10024119 15.3 0.7511
AT2G36930 C2H2ZnF zinc finger (C2H2 type) family... Lus10023928 17.4 0.7570
AT3G58810 ATMTPA2, MTP3, ... ARABIDOPSIS METAL TOLERANCE PR... Lus10002674 19.2 0.7556
AT1G02020 nitroreductase family protein ... Lus10030289 19.4 0.7404
AT1G74250 DNAJ heat shock N-terminal dom... Lus10017846 20.1 0.7197
AT5G41685 Mitochondrial outer membrane t... Lus10001641 20.4 0.7137
AT2G21290 unknown protein Lus10018053 22.6 0.7178

Lus10017248 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.