Lus10017263 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17880 103 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1)
AT4G36040 101 / 1e-27 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
AT3G13310 84 / 9e-21 Chaperone DnaJ-domain superfamily protein (.1)
AT4G13830 72 / 3e-16 J20 DNAJ-like 20 (.1.2)
AT4G39960 66 / 4e-13 Molecular chaperone Hsp40/DnaJ family protein (.1)
AT4G37480 66 / 8e-13 Chaperone DnaJ-domain superfamily protein (.1)
AT2G22360 64 / 3e-12 DNAJ heat shock family protein (.1)
AT1G59980 63 / 5e-12 GPS4, ARL2 ,ATDJC39 gravity persistence signal 4, ARG1-like 2 (.1)
AT2G21510 62 / 9e-12 DNAJ heat shock N-terminal domain-containing protein (.1)
AT4G39150 60 / 6e-11 DNAJ heat shock N-terminal domain-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013558 154 / 2e-49 AT4G36040 82 / 1e-21 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10041906 109 / 7e-31 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10028453 106 / 2e-29 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1)
Lus10034484 89 / 3e-23 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10025060 86 / 3e-22 AT4G36040 102 / 7e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1)
Lus10032957 86 / 1e-21 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1)
Lus10002355 86 / 3e-21 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2)
Lus10003150 82 / 2e-19 AT4G13830 151 / 3e-46 DNAJ-like 20 (.1.2)
Lus10002356 77 / 1e-17 AT4G13830 144 / 1e-43 DNAJ-like 20 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G020800 173 / 8e-56 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1)
Potri.005G240700 167 / 2e-53 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G020700 165 / 1e-52 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1)
Potri.004G172300 115 / 2e-33 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.009G131800 109 / 1e-31 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1)
Potri.005G113100 106 / 9e-30 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1)
Potri.001G469600 89 / 9e-23 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1)
Potri.011G166500 86 / 3e-21 AT3G13310 115 / 4e-33 Chaperone DnaJ-domain superfamily protein (.1)
Potri.006G001301 83 / 2e-20 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1)
Potri.007G107600 78 / 8e-19 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0392 Chaperone-J PF00226 DnaJ DnaJ domain
Representative CDS sequence
>Lus10017263 pacid=23165811 polypeptide=Lus10017263 locus=Lus10017263.g ID=Lus10017263.BGIv1.0 annot-version=v1.0
ATGGCTTTCACGTCTTCTTTTCTCTGCTCCTCCTCCTCATCTTCTTCTTCTCTAATCGTTCCGAATCTCGATCACAGGGCCACTTCGTTTCCTTCGCCTT
CCCGGGTCGGGCTCCGGCCGCTTCGCGTCTCCGCTTCTTGCGCGGCTACCGCCGAGAGGGGAACCAGCACGATGACGACGGCGGCGGCGCGTCGACGGTC
TTCCTTTTATGAGGTGCTGGGGATTCAGACGGGCGCCACGTGTCAGGAGATCAAGGCCGCTTACAGACAAATGGCAAGAGTCCTCCACCCGGACGTTGCC
GCCGGCGAGGATGACAGTACCGCGAGCGAGTTCATTAAATTGCACGAGGCGTACGAAACGCTTTCAGATCCGGAGAAACGGGCGGATTACGACCGGACTC
TGTTCTGGGTGGGGCGGTCATTGAGCTATGCGTTTGTGATGTCGCCTGCTGCGTCGGGTTCGGGTCAGTCCGGGTACACTAGCCGAAGATGGGAAACGGA
TCAGTGCTGGTAG
AA sequence
>Lus10017263 pacid=23165811 polypeptide=Lus10017263 locus=Lus10017263.g ID=Lus10017263.BGIv1.0 annot-version=v1.0
MAFTSSFLCSSSSSSSSLIVPNLDHRATSFPSPSRVGLRPLRVSASCAATAERGTSTMTTAAARRRSSFYEVLGIQTGATCQEIKAAYRQMARVLHPDVA
AGEDDSTASEFIKLHEAYETLSDPEKRADYDRTLFWVGRSLSYAFVMSPAASGSGQSGYTSRRWETDQCW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36040 J11 DnaJ11, Chaperone DnaJ-domain ... Lus10017263 0 1
AT4G36040 J11 DnaJ11, Chaperone DnaJ-domain ... Lus10013558 3.5 0.7780
AT2G27930 PLATZ transcription factor fam... Lus10036044 10.4 0.7761
AT1G69040 ACR4 ACT domain repeat 4 (.1.2) Lus10036827 12.5 0.7251
Lus10009372 12.6 0.7443
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029390 14.6 0.7443
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10029913 16.3 0.7443
Lus10001325 17.7 0.6960
Lus10000400 17.8 0.7443
AT4G29280 LCR22 low-molecular-weight cysteine-... Lus10015983 19.3 0.7443
AT4G38260 Protein of unknown function (D... Lus10012254 20.0 0.5674

Lus10017263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.