Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35070 89 / 2e-21 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT3G12920 67 / 4e-13 BRG3 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) AT1G79110 65 / 4e-12 BRG2 BOI-related gene 2, zinc ion binding (.1.2) AT1G45976 62 / 3e-11 SBP1 S-ribonuclease binding protein 1 (.1) AT1G32740 58 / 6e-10 SBP (S-ribonuclease binding protein) family protein (.1) AT1G10650 57 / 1e-09 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT5G47050 57 / 2e-09 SBP (S-ribonuclease binding protein) family protein (.1) AT5G45100 56 / 3e-09 BRG1 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT1G60610 53 / 5e-08 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2), SBP (S-ribonuclease binding protein) family protein (.3) AT4G19700 51 / 2e-07 BOI, RING Botrytis Susceptible1 Interactor, SBP (S-ribonuclease binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013569 [exp] 263 / 2e-88 AT4G35070 125 / 1e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10014118 [exp] 131 / 5e-38 AT4G35070 171 / 7e-54 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10019790 [exp] 128 / 7e-37 AT4G35070 170 / 1e-53 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030891 [exp] 65 / 2e-12 AT1G10650 275 / 1e-92 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10013027 [exp] 65 / 4e-12 AT1G10650 382 / 3e-133 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030597 [exp] 65 / 4e-12 AT1G10650 380 / 3e-132 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030599 [exp] 65 / 4e-12 AT1G10650 380 / 4e-132 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10001131 [exp] 62 / 3e-11 AT1G45976 407 / 7e-143 S-ribonuclease binding protein 1 (.1) Lus10031780 [exp] 61 / 1e-10 AT3G12920 260 / 3e-85 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G019000 [exp] 137 / 3e-39 AT4G35070 148 / 6e-43 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.005G242600 [exp] 128 / 4e-36 AT4G35070 135 / 3e-38 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.004G175500 [exp] 108 / 2e-28 AT4G35070 142 / 1e-41 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.009G135400 [exp] 95 / 3e-23 AT4G35070 135 / 6e-39 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.010G042200 [exp] 66 / 1e-12 AT1G10650 393 / 2e-137 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.014G027000 [exp] 64 / 1e-11 AT1G45976 380 / 2e-132 S-ribonuclease binding protein 1 (.1) Potri.012G082200 [exp] 62 / 3e-11 AT1G10650 266 / 2e-87 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.002G124700 [exp] 62 / 4e-11 AT1G45976 378 / 2e-131 S-ribonuclease binding protein 1 (.1) Potri.001G439600 [exp] 61 / 6e-11 AT3G12920 256 / 1e-83 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Potri.001G148600 [exp] 61 / 7e-11 AT1G32740 221 / 4e-70 SBP (S-ribonuclease binding protein) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017276 pacid=23165869 polypeptide=Lus10017276 locus=Lus10017276.g ID=Lus10017276.BGIv1.0 annot-version=v1.0 ATGGCTGTTCAAGCTCAGCCCTTTCTCTTCCCCATGTGTGGTTCCCAGGATTTCATCCCCAATTTCTCCGACCTCGATCATCACCTCCCCCCCTGTTTCC CTAGTTTCCATGACTCCCATCCACACATATCACCACCCAACACCCTCCTCCTCCGACACCTCCAGACTCAGCGGCAGGAGCTCGACGCCATTCTCCAACT ACAGAACGAGAGGCTGAGAATGGCGTTGCAAGAACAGAGGAAGCAACAAATAGGGGTTCTATTGAAAGGAATCGAAGTCCGTGCCACGTCGATGCTGAGG CGGAAGCAGGATGACCTGGCATTAGCGGCGAGGAAAAGGGCCGAGCTGGAGGCTTGCTTAAGTAGAGCTGAGGCGGAGAAGGACAAGTGGCAAAGACTGG CTATGGAGAAGGAAGCGGCCGTGGCGGATCTTAAACGCCAGCTGGAGCAAATCACAGACGATGCAGAGTCTTCCGCCGGAGATGATGAGTGGGATAGAAG TGGAAATGGCGGTGGTGGTGGTTGCAAGCGGTGCGGGGTCGGAGAGGCGTGTATGGTGTTTCTGCCGTGTAGGCATGTGTGCTCCTGCAAGGACTGTGAA GGGTTTCTGGCCATTTGTCCTGTCTGTACATCTCTCAAGGAAGCCACCCTCGAGGTTTTCTTGTCTTCTGCCTCTGTAAACTAA
AA sequence Show only first row Show all	>Lus10017276 pacid=23165869 polypeptide=Lus10017276 locus=Lus10017276.g ID=Lus10017276.BGIv1.0 annot-version=v1.0 MAVQAQPFLFPMCGSQDFIPNFSDLDHHLPPCFPSFHDSHPHISPPNTLLLRHLQTQRQELDAILQLQNERLRMALQEQRKQQIGVLLKGIEVRATSMLR RKQDDLALAARKRAELEACLSRAEAEKDKWQRLAMEKEAAVADLKRQLEQITDDAESSAGDDEWDRSGNGGGGGCKRCGVGEACMVFLPCRHVCSCKDCE GFLAICPVCTSLKEATLEVFLSSASVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35070			SBP (S-ribonuclease binding pr...		Lus10017276 [exp]	0	1
AT1G08650		ATPPCK1, PPCK1	phosphoenolpyruvate carboxylas...		Lus10011823 [exp]	8.9	0.6568
					Lus10023658 [exp]	22.8	0.6118
AT3G43660			Vacuolar iron transporter (VIT...		Lus10042804 [exp]	30.7	0.5868
AT3G55390			Uncharacterised protein family...		Lus10005154 [exp]	48.3	0.6266
AT1G02010		SEC1A	secretory 1A (.1.2)		Lus10015870 [exp]	52.2	0.6044
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Lus10002720 [exp]	58.9	0.6184
AT1G47840		HXK3	hexokinase 3 (.1)		Lus10002041 [exp]	66.7	0.6173
AT3G02210		COBL1	COBRA-like protein 1 precursor...		Lus10012598 [exp]	72.5	0.6089
AT1G05370			Sec14p-like phosphatidylinosit...		Lus10021919 [exp]	111.7	0.5752
					Lus10033740 [exp]	131.0	0.5749

Compare expression of checked genes

Lus10017276 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.