Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42190 259 / 6e-90 SKP1B, ASK2 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) AT1G75950 257 / 3e-89 UIP1, SKP1A, ATSKP1, ASK1, SKP1 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) AT1G20140 229 / 3e-78 ASK4 SKP1-like 4 (.1) AT2G25700 217 / 3e-73 ASK3 SKP1-like 3 (.1) AT4G34210 211 / 5e-71 ASK11 SKP1-like 11 (.1) AT4G34470 204 / 1e-68 ASK12 SKP1-like 12 (.1) AT3G60010 194 / 2e-64 ASK13 SKP1-like 13 (.1) AT3G21860 187 / 1e-61 ASK10 SKP1-like 10 (.1) AT3G21850 186 / 3e-61 ASK9 SKP1-like 9 (.1) AT2G03170 177 / 1e-57 ASK14 SKP1-like 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005610 [exp] 301 / 7e-107 AT5G42190 261 / 2e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Lus10017282 [exp] 299 / 9e-106 AT5G42190 259 / 6e-90 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Lus10013575 [exp] 294 / 6e-104 AT1G75950 255 / 2e-88 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Lus10019794 [exp] 247 / 4e-85 AT1G75950 241 / 8e-83 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Lus10014115 [exp] 244 / 3e-78 AT1G68010 700 / 0.0 hydroxypyruvate reductase (.1.2) Lus10041874 [exp] 208 / 7e-70 AT4G34210 201 / 3e-67 SKP1-like 11 (.1) Lus10019432 [exp] 188 / 4e-62 AT1G20140 186 / 2e-61 SKP1-like 4 (.1) Lus10002803 [exp] 174 / 3e-56 AT1G20140 189 / 3e-62 SKP1-like 4 (.1) Lus10031747 [exp] 101 / 2e-27 AT2G03190 104 / 7e-29 SKP1-like 16 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G018700 [exp] 273 / 1e-95 AT5G42190 249 / 6e-86 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.005G243100 [exp] 268 / 1e-93 AT1G75950 244 / 2e-84 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Potri.005G109900 [exp] 266 / 1e-92 AT5G42190 249 / 5e-86 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.004G175900 [exp] 251 / 1e-86 AT5G42190 245 / 2e-84 Arabidopsis SKP-like 2, E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein (.1) Potri.009G135800 [exp] 236 / 8e-81 AT1G20140 215 / 9e-73 SKP1-like 4 (.1) Potri.012G085200 [exp] 150 / 3e-47 AT4G34210 157 / 7e-50 SKP1-like 11 (.1) Potri.001G132300 [exp] 127 / 3e-38 AT1G75950 122 / 3e-36 UFO INTERACTING PROTEIN 1, ARABIDOPSIS SKP1 HOMOLOGUE 1, S phase kinase-associated protein 1 (.1) Potri.012G086900 [exp] 122 / 3e-36 AT4G34210 130 / 1e-39 SKP1-like 11 (.1) Potri.005G094800 [exp] 119 / 1e-34 AT3G21860 114 / 2e-32 SKP1-like 10 (.1) Potri.016G028300 [exp] 79 / 7e-19 AT2G03170 79 / 6e-19 SKP1-like 14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0033 [flax] [poplar] POZ PF03931 [flax] [poplar] Skp1_POZ Skp1 family, tetramerisation domain CL0033 [flax] [poplar] PF01466 [flax] [poplar] Skp1 Skp1 family, dimerisation domain
Representative CDS sequence Show only first row Show all	>Lus10017281 pacid=23165827 polypeptide=Lus10017281 locus=Lus10017281.g ID=Lus10017281.BGIv1.0 annot-version=v1.0 ATGTCGACTGCCAGGAAAATAACTCTCAAGAGCTCCGATGGGGAGACGTTCGAGGTAGACGAGGCGGTAGCTTTGGAATCGCAAACCATCAAGCACATGA TCGAAGACGACTGCGCCGATAACGGCATCCCTCTCCCGAACGTCACCAGCAAAATCCTCTCTAAGGTCATCGAGTACTGCAAGAGGCATGTCGAGGTTGC TGCCACCAAGACCGAGGATCGCCCTACCACTGCGGACGACGATCTCAAGAATTGGGACGCCGAATTCGTCAAGGTCGATCAGGCCACTCTCTTCGATCTG ATTCTGGCTGCGAACTATCTGAACATCAAGAGCTTGCTAGACCTAACTTGTCAGACGGTGGCTGACATGATAAAAGGGAAAACTCCAGAGGAAATCCGCA AGACTTTCAACATCAAGAATGACTTCACCCCTGAGGAAGAAGAGGAAGTTCGTCGAGAGAACCAATGGGCATTTGAGTGA
AA sequence Show only first row Show all	>Lus10017281 pacid=23165827 polypeptide=Lus10017281 locus=Lus10017281.g ID=Lus10017281.BGIv1.0 annot-version=v1.0 MSTARKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKRHVEVAATKTEDRPTTADDDLKNWDAEFVKVDQATLFDL ILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42190		SKP1B, ASK2	Arabidopsis SKP-like 2, E3 ubi...		Lus10017281 [exp]	0	1
AT1G17730		CHMP1B, VPS46.1	CHARGED MULTIVESICULAR BODY PR...		Lus10037607 [exp]	1.0	0.8802
AT1G78310			VQ motif-containing protein (....		Lus10036479 [exp]	1.4	0.8734
AT1G78310			VQ motif-containing protein (....		Lus10010346 [exp]	2.8	0.8620
AT1G12440			A20/AN1-like zinc finger famil...		Lus10007015 [exp]	4.2	0.8351
AT5G22950		VPS24.1	SNF7 family protein (.1)		Lus10021423 [exp]	4.6	0.8644
AT3G56190		ASNAP, ALPHA-SN...	alpha-soluble NSF attachment p...		Lus10032835 [exp]	5.5	0.8464
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10005088 [exp]	5.9	0.8394
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10012580 [exp]	6.3	0.8382
AT1G77180		SKIP	chromatin protein family (.1.2...		Lus10027158 [exp]	9.2	0.8482
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10043185 [exp]	11.6	0.8080

Compare expression of checked genes

Lus10017281 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.