Lus10017292 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22880 187 / 3e-62 HTB2, H2B HISTONE H2B, histone B2 (.1)
AT1G07790 187 / 5e-62 HTB1 Histone superfamily protein (.1)
AT3G46030 186 / 2e-61 HTB11 Histone superfamily protein (.1)
AT3G45980 186 / 2e-61 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT3G53650 183 / 1e-60 Histone superfamily protein (.1)
AT5G59910 182 / 4e-60 HTB4 Histone superfamily protein (.1)
AT2G28720 182 / 7e-60 Histone superfamily protein (.1)
AT2G37470 179 / 4e-59 Histone superfamily protein (.1)
AT5G02570 173 / 1e-56 Histone superfamily protein (.1)
AT3G09480 168 / 8e-55 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037371 191 / 2e-63 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10041347 190 / 3e-63 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10013544 190 / 3e-63 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10005897 189 / 1e-62 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Lus10005893 189 / 1e-62 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1)
Lus10016156 188 / 2e-62 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Lus10040855 187 / 6e-62 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1)
Lus10017456 186 / 1e-61 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10023753 183 / 1e-60 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G029900 189 / 8e-63 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.010G230600 188 / 1e-62 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
Potri.010G230801 188 / 1e-62 AT1G07790 205 / 2e-69 Histone superfamily protein (.1)
Potri.010G231300 187 / 5e-62 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.008G030600 186 / 8e-62 AT5G59910 188 / 2e-62 Histone superfamily protein (.1)
Potri.010G230701 185 / 3e-61 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.004G091200 185 / 4e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.009G028001 184 / 4e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.017G123700 184 / 5e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091400 184 / 7e-61 AT2G28720 186 / 1e-61 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10017292 pacid=23165747 polypeptide=Lus10017292 locus=Lus10017292.g ID=Lus10017292.BGIv1.0 annot-version=v1.0
ATGGCGCCCAAGGCAGAGAAGAAACCAGCAGAGAAGAAGCCAGCGGAGAAAGCTCCCGTTGCCGAGAAGAAGCCCCGCGCCGAGAAGAAGCTCCCCAAGG
AAGGAGGAGCCGCCGCCGCCGCCGACAAGAAGAAGAAGCGGAACAAGAAGAACGTAGAGACCTACAAGATCTACATTTTCAAGGTCCTGAAGCAGGTTCA
TCCGGACATTGGGATCTCCAGCAAGGCCATGGGAATCATGAACAGCTTCATCAACGACATCTTCGAGAAGCTCGCCGCCGAGTCCTCCAGGCTTGCGAGG
TACAACAAGAAGCCGACGATTACTTCTCGCGAGATCCAGACCGCCGTCAGGCTTGTTCTTCCCGGTGAGCTGGCGAAGCACGCTGTTTCTGAAGGGACTA
AGGCTGTCACCAAGTTTACCAGCTCTTAG
AA sequence
>Lus10017292 pacid=23165747 polypeptide=Lus10017292 locus=Lus10017292.g ID=Lus10017292.BGIv1.0 annot-version=v1.0
MAPKAEKKPAEKKPAEKAPVAEKKPRAEKKLPKEGGAAAAADKKKKRNKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAAESSRLAR
YNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10017292 0 1
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10041347 1.0 0.9880
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10004945 1.7 0.9793
AT5G59690 Histone superfamily protein (.... Lus10014264 2.0 0.9878
AT5G48480 Lactoylglutathione lyase / gly... Lus10020399 2.6 0.9757
AT1G73620 Pathogenesis-related thaumatin... Lus10009058 3.5 0.9792
AT1G09200 Histone superfamily protein (.... Lus10005271 3.5 0.9759
AT3G29300 unknown protein Lus10034904 4.2 0.9724
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10037371 5.9 0.9780
AT4G11080 3xHMG-box1 3xHigh Mobility Group-box1, HM... Lus10003904 6.0 0.9670
AT3G02820 zinc knuckle (CCHC-type) famil... Lus10012910 7.1 0.9628

Lus10017292 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.