Lus10017293 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64140 86 / 4e-23 RPS28 ribosomal protein S28 (.1)
AT5G03850 86 / 4e-23 Nucleic acid-binding, OB-fold-like protein (.1)
AT3G10090 86 / 4e-23 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016222 105 / 2e-30 AT3G10090 111 / 3e-34 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10029320 105 / 2e-30 AT3G10090 111 / 3e-34 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10013543 103 / 5e-28 AT5G64140 114 / 4e-33 ribosomal protein S28 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G013200 97 / 4e-27 AT5G64140 90 / 5e-26 ribosomal protein S28 (.1)
Potri.010G245400 97 / 4e-27 AT5G64140 90 / 5e-26 ribosomal protein S28 (.1)
Potri.016G063100 96 / 4e-27 AT5G64140 89 / 1e-25 ribosomal protein S28 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF01200 Ribosomal_S28e Ribosomal protein S28e
Representative CDS sequence
>Lus10017293 pacid=23165793 polypeptide=Lus10017293 locus=Lus10017293.g ID=Lus10017293.BGIv1.0 annot-version=v1.0
ATGCCCCCCACTACAAAAGGCCTAAGGATTCTAGTACAGCAGCCTTCCTTGCAAAATCGCCGAGAGAAAAACCTAGTAGCAGCTGCAGCAGCCCGCCGTT
GTCCGCTTCCATCGCTCTCATCTCGTCGGAGCTTCCTCTTGCAATTGAAGACTGGTTGGATGGTGGAGATATTTCTAGGGTGCTTTGTTTGCTATCTCTT
TCGAATGGATTCTAATTGCTGTCCTCGTGGATCTGGTGCAATCGAAGAACTGATGGAATCTGGGATCAAGCATGCTTTGGTGGTGAAAGTGATGGGCCGT
ACTGGATCGAGGGGTCAGGTGACTCAAGTCAGGGTCAAGTTCATCGATGATCCTAACCGTTTCATCATGAGGAATGTCAAGGGACCAGTGAGAGAAGGTG
ACATCCTCACCTTGCTCGAATCCGAGAGAGAGGCCAGGAGACTTCGTTGA
AA sequence
>Lus10017293 pacid=23165793 polypeptide=Lus10017293 locus=Lus10017293.g ID=Lus10017293.BGIv1.0 annot-version=v1.0
MPPTTKGLRILVQQPSLQNRREKNLVAAAAARRCPLPSLSSRRSFLLQLKTGWMVEIFLGCFVCYLFRMDSNCCPRGSGAIEELMESGIKHALVVKVMGR
TGSRGQVTQVRVKFIDDPNRFIMRNVKGPVREGDILTLLESEREARRLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G10090 Nucleic acid-binding, OB-fold-... Lus10017293 0 1
AT1G54380 spliceosome protein-related (.... Lus10022813 1.7 0.8213
AT1G71730 unknown protein Lus10029741 3.5 0.8050
AT2G24050 eIFiso4G2 eukaryotic translation Initiat... Lus10035812 4.1 0.7131
AT5G24510 60S acidic ribosomal protein f... Lus10008944 4.5 0.8073
AT4G15770 RNA binding (.1) Lus10000507 5.2 0.8061
AT5G20920 EIF2 BETA, EMB1... embryo defective 1401, eukaryo... Lus10012186 5.5 0.7971
AT5G24510 60S acidic ribosomal protein f... Lus10002680 6.3 0.7994
AT1G05600 EMB3101 EMBRYO DEFECTIVE 3101, Tetratr... Lus10030200 9.9 0.7905
AT3G05560 Ribosomal L22e protein family ... Lus10026555 13.1 0.7682
AT3G59520 ATRBL13 RHOMBOID-like protein 13 (.1) Lus10008156 13.3 0.7629

Lus10017293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.