Lus10017298 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02750 302 / 3e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G20230 224 / 3e-68 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G21065 213 / 2e-66 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT4G16835 216 / 1e-65 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G13650 219 / 7e-65 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G37170 211 / 2e-63 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G13600 211 / 3e-63 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G26782 210 / 3e-63 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G22070 211 / 5e-63 pentatricopeptide (PPR) repeat-containing protein (.1)
AT5G04780 209 / 5e-63 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013540 387 / 3e-130 AT4G02750 1075 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010998 230 / 2e-70 AT4G16835 778 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036921 225 / 1e-68 AT4G37170 806 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013991 223 / 1e-66 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040577 210 / 5e-66 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10015414 219 / 2e-65 AT3G57430 629 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000597 208 / 1e-64 AT4G16835 545 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10004892 216 / 3e-64 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030908 217 / 5e-64 AT1G68930 928 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G048800 323 / 1e-105 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G091600 228 / 6e-70 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G220300 228 / 1e-69 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G155100 227 / 7e-69 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G047800 225 / 2e-67 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G136200 222 / 2e-67 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.013G058900 224 / 9e-67 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G027800 221 / 9e-67 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G021300 219 / 3e-66 AT1G20230 852 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G104700 218 / 7e-66 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10017298 pacid=23165800 polypeptide=Lus10017298 locus=Lus10017298.g ID=Lus10017298.BGIv1.0 annot-version=v1.0
ATGCCTATAAAAGACGAGGTTTCATGGAATACGATGATTACTGGTTATGCACAGAAGGGAGAAGTGGAAGAAGCGCAGAGATTGTTTGATCAGTCTCCAA
CTAAGGATGTGTTTACATGGACTTCAATGGTTTCTGGATATGTCCAAAACAGTTGGTGTACTGTCTGCCTTGGTCACGCTGGTTTAGTAGACAAAGGGAC
TGAATGTTTCTATTCAATGACCCAAGAGTACGGAATAACACCAAATCCTGTGCACTACACTTGCATGGTTCATCTCTTGGGTCGAGCTGGGCGCCTGAAG
GAGGCCCAGGAACTAATAAAGAAGATGCCTTTCAAACCAGATGCTGCAGCTTGGGGAGCTTTACTTGGTGCGAGCAGAGTGCATGGAAATATTGAACTGG
GTGAAAGTGTTGCGGATACTATTTTCAGTATGGAGCCTAATAATTCCGGCATGTACATTCTCCTATCAAATTTATACGCAGCTTTAGGTAGATGGCCGGA
AGTTGATAGGATGAGACGGAGAATGAGGAATGAAGGCGTCAAGAAAGTGCCCGGCTATAGCTGGCTCGAAGTGCAGAACGAAATTCATACTTTTCGAGTT
GGGGACACCTCTCATCCAGACAAGGATAGGATATACTCATTTTTAGCCGAGATGGTGCAGAAGATGAAGCAGGAGGGCTACGTTTCATTGACGAAATTGG
TGTTACATGATGTGGAAGAGGAAGAGAAGGAGCATATGCTGGAGTTGCACAGCGAGAAATTGGCCGTAGCGTACGGGATTCTATCTGTCCCTGCTGGTAG
ACCGGTCCGCGTGATAAAGAACTAG
AA sequence
>Lus10017298 pacid=23165800 polypeptide=Lus10017298 locus=Lus10017298.g ID=Lus10017298.BGIv1.0 annot-version=v1.0
MPIKDEVSWNTMITGYAQKGEVEEAQRLFDQSPTKDVFTWTSMVSGYVQNSWCTVCLGHAGLVDKGTECFYSMTQEYGITPNPVHYTCMVHLLGRAGRLK
EAQELIKKMPFKPDAAAWGALLGASRVHGNIELGESVADTIFSMEPNNSGMYILLSNLYAALGRWPEVDRMRRRMRNEGVKKVPGYSWLEVQNEIHTFRV
GDTSHPDKDRIYSFLAEMVQKMKQEGYVSLTKLVLHDVEEEEKEHMLELHSEKLAVAYGILSVPAGRPVRVIKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02750 Tetratricopeptide repeat (TPR)... Lus10017298 0 1
AT5G05800 unknown protein Lus10007443 4.5 0.6755
AT5G20950 Glycosyl hydrolase family prot... Lus10013390 11.2 0.6252
AT4G22380 Ribosomal protein L7Ae/L30e/S1... Lus10017031 18.2 0.6664
AT2G01640 unknown protein Lus10027869 18.7 0.6480
AT4G24320 Ubiquitin carboxyl-terminal hy... Lus10027445 21.0 0.6227
AT1G12700 RPF1 RNA processing factor 1, ATP b... Lus10014244 23.5 0.6568
AT5G61930 APO3 ACCUMULATION OF PHOTOSYSTEM ON... Lus10005547 27.6 0.6520
AT3G46100 ATHRS1 Histidyl-tRNA synthetase 1 (.1... Lus10023925 30.9 0.6419
AT1G62930 RPF3 RNA processing factor 3, Tetra... Lus10021074 45.9 0.5841
AT1G52620 Pentatricopeptide repeat (PPR)... Lus10026791 47.3 0.6018

Lus10017298 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.