Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14240 92 / 4e-23 Subtilase family protein (.1) AT4G34980 68 / 9e-15 SLP2 subtilisin-like serine protease 2 (.1) AT3G14067 67 / 2e-14 Subtilase family protein (.1) AT5G67360 66 / 3e-14 ARA12 Subtilase family protein (.1) AT1G04110 62 / 1e-12 SDD1 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) AT2G05920 61 / 3e-12 Subtilase family protein (.1) AT5G51750 57 / 4e-11 ATSBT1.3 subtilase 1.3 (.1) AT5G03620 57 / 9e-11 Subtilisin-like serine endopeptidase family protein (.1) AT5G67090 53 / 2e-09 Subtilisin-like serine endopeptidase family protein (.1) AT5G59810 52 / 3e-09 ATSBT5.4 Subtilase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034178 [exp] 132 / 3e-39 AT3G14240 240 / 4e-73 Subtilase family protein (.1) Lus10034517 [exp] 98 / 5e-27 AT3G14240 209 / 1e-63 Subtilase family protein (.1) Lus10013187 [exp] 100 / 7e-26 AT3G14240 1175 / 0.0 Subtilase family protein (.1) Lus10037449 [exp] 100 / 8e-26 AT3G14240 1177 / 0.0 Subtilase family protein (.1) Lus10009867 [exp] 66 / 8e-14 AT5G59190 629 / 0.0 subtilase family protein (.1) Lus10040253 [exp] 64 / 2e-13 AT5G59090 640 / 0.0 subtilase 4.12 (.1.2.3) Lus10011089 [exp] 64 / 2e-13 AT5G67360 1108 / 0.0 Subtilase family protein (.1) Lus10004685 [exp] 64 / 2e-13 AT4G00230 647 / 0.0 xylem serine peptidase 1 (.1) Lus10000394 [exp] 63 / 4e-13 AT5G59190 359 / 1e-118 subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G071800 [exp] 93 / 1e-23 AT3G14240 1199 / 0.0 Subtilase family protein (.1) Potri.001G163600 [exp] 93 / 1e-23 AT3G14240 1174 / 0.0 Subtilase family protein (.1) Potri.004G173900 [exp] 75 / 2e-17 AT4G34980 1108 / 0.0 subtilisin-like serine protease 2 (.1) Potri.009G133400 [exp] 71 / 5e-16 AT4G34980 1121 / 0.0 subtilisin-like serine protease 2 (.1) Potri.012G131500 [exp] 66 / 4e-14 AT5G51750 1102 / 0.0 subtilase 1.3 (.1) Potri.003G067000 [exp] 63 / 3e-13 AT3G14067 969 / 0.0 Subtilase family protein (.1) Potri.010G196700 [exp] 62 / 7e-13 AT5G59100 579 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.001G167300 [exp] 62 / 8e-13 AT3G14067 978 / 0.0 Subtilase family protein (.1) Potri.015G133800 [exp] 62 / 1e-12 AT5G51750 1113 / 0.0 subtilase 1.3 (.1) Potri.005G145300 [exp] 61 / 2e-12 AT5G67360 932 / 0.0 Subtilase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017301 pacid=23165853 polypeptide=Lus10017301 locus=Lus10017301.g ID=Lus10017301.BGIv1.0 annot-version=v1.0 ATGATCGACCGATTCGAGTTTCAGCACCGCGCCTCCCCCCACCCCGCTCCACCCCCCCCCGGCCGCTACGTTTTCCCCGCTTCCACTCTCGGATACGCTC GTGGACTCGCTGCTGGTATGGCTCCTAAAGCTAGACTCGCTGTCTATAAAGTCTGCTGGACTGCTGGCTGCTACGATTCCGATATCCTCACTGCGTTCGA CGTTGTAGCAGAAGAAGAAGCTTTACCCGCACGAGCTAGCTTTCCTTCTTCCTTAGTGTTTTCCTGA
AA sequence Show only first row Show all	>Lus10017301 pacid=23165853 polypeptide=Lus10017301 locus=Lus10017301.g ID=Lus10017301.BGIv1.0 annot-version=v1.0 MIDRFEFQHRASPHPAPPPPGRYVFPASTLGYARGLAAGMAPKARLAVYKVCWTAGCYDSDILTAFDVVAEEEALPARASFPSSLVFS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14240			Subtilase family protein (.1)		Lus10017301 [exp]	0	1
AT3G14240			Subtilase family protein (.1)		Lus10034517 [exp]	3.5	0.8831
AT4G29840		TS, MTO2	THREONINE SYNTHASE, METHIONINE...		Lus10003317 [exp]	5.1	0.8583
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10022418 [exp]	5.5	0.8708
AT3G14240			Subtilase family protein (.1)		Lus10037449 [exp]	6.2	0.8797
AT3G14240			Subtilase family protein (.1)		Lus10013187 [exp]	6.2	0.8904
AT3G14240			Subtilase family protein (.1)		Lus10034178 [exp]	7.7	0.8635
AT3G48680		AtCAL2, GAMMACA...	gamma carbonic anhydrase-like ...		Lus10031847 [exp]	10.6	0.8669
AT4G23490			Protein of unknown function (D...		Lus10024662 [exp]	12.7	0.8651
AT2G40950	bZIP	BZIP17	Basic-leucine zipper (bZIP) tr...		Lus10012104 [exp]	13.4	0.8590
AT1G71740			unknown protein		Lus10041497 [exp]	13.7	0.8759

Compare expression of checked genes

Lus10017301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.