Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042896 [exp] 73 / 6e-16 AT3G60380 91 / 1e-18 unknown protein Lus10033071 [exp] 69 / 1e-14 ND 39 / 0.005 Lus10033089 [exp] 67 / 5e-14 ND / Lus10017075 [exp] 57 / 4e-11 ND / Lus10006097 [exp] 52 / 5e-09 AT4G29090 43 / 8e-05 Ribonuclease H-like superfamily protein (.1) Lus10041736 [exp] 51 / 1e-08 ND 37 / 0.006
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017303 pacid=23140251 polypeptide=Lus10017303 locus=Lus10017303.g ID=Lus10017303.BGIv1.0 annot-version=v1.0 ATGGAACCAAATGTAACAGCTGCAATACTTAAACCACAGATGGGAAAGCTCGCAGGGAAAAACCAAGAGCTGCAGAAAATTGCAGGGGTGTCATTTCAGC AGCCTACGACGTGGATTATCTCAGTGGATGTTTCGGTTTGCCCTCTTTTGGGTTATGGAGATGTGGGGTTCGTGGTGCGACACTCCTATGGCTCTCTAGT TTCTGCAACAGGGCAGGGCATCCCCCACATCGTGGATTCCTTGGTCTTGGAGGTCTTGGCTATCTGTCAAGCCCTTTTTGTCGTTGCGGTCCGTCACCTT GAAGCCTTCCAAATCTTGTCTGACACTACGGACTCTTCGCCTTCTCAACTCGTCCATCCCTGA
AA sequence Show only first row Show all	>Lus10017303 pacid=23140251 polypeptide=Lus10017303 locus=Lus10017303.g ID=Lus10017303.BGIv1.0 annot-version=v1.0 MEPNVTAAILKPQMGKLAGKNQELQKIAGVSFQQPTTWIISVDVSVCPLLGYGDVGFVVRHSYGSLVSATGQGIPHIVDSLVLEVLAICQALFVVAVRHL EAFQILSDTTDSSPSQLVHP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017303 [exp]	0	1
					Lus10011061 [exp]	2.6	1.0000
					Lus10009800 [exp]	5.3	1.0000
AT3G07740		HXA2, HXA02, HA...	homolog of yeast ADA2 2A (.1.2...		Lus10012337 [exp]	7.0	1.0000
					Lus10011496 [exp]	7.1	1.0000
					Lus10011848 [exp]	9.2	1.0000
AT5G46795		MSP2	microspore-specific promoter ...		Lus10004566 [exp]	9.2	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10011845 [exp]	9.7	1.0000
AT4G10020		ATHSD5	hydroxysteroid dehydrogenase 5...		Lus10001280 [exp]	9.8	1.0000
					Lus10011759 [exp]	10.4	1.0000
AT1G12570			Glucose-methanol-choline (GMC)...		Lus10002957 [exp]	11.2	1.0000

Compare expression of checked genes

Lus10017303 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.