Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023044 [exp] 39 / 0.0001 AT5G18880 44 / 4e-05 RNA-directed DNA polymerase (reverse transcriptase)-related family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017305 pacid=23140245 polypeptide=Lus10017305 locus=Lus10017305.g ID=Lus10017305.BGIv1.0 annot-version=v1.0 ATGGCCACTTATACTCATAGTAAACTCATAAAGCTCACTCTCATCTTCCTGCTGATCTTCATCTTCATTCATCCATCGCAAGCTCACTCTCGATTAACCG CTGCAGCCGATCAGGGGAAGATGGACATCATGGATATGGAATTGGACTACGTGAAAGATCCAGGAGCAAACACCAAGCACTTGCCAGCTCCCAAGCCTCC AAAACCAGCAGTTGGTGTTGGTGGCTGA
AA sequence Show only first row Show all	>Lus10017305 pacid=23140245 polypeptide=Lus10017305 locus=Lus10017305.g ID=Lus10017305.BGIv1.0 annot-version=v1.0 MATYTHSKLIKLTLIFLLIFIFIHPSQAHSRLTAAADQGKMDIMDMELDYVKDPGANTKHLPAPKPPKPAVGVGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017305 [exp]	0	1
AT2G42005			Transmembrane amino acid trans...		Lus10026549 [exp]	3.5	0.9751
AT1G12260	NAC	ANAC007, VND4, ...	VASCULAR RELATED NAC-DOMAIN PR...		Lus10031721 [exp]	3.5	0.9779
AT4G12350	MYB	ATMYB42	myb domain protein 42 (.1)		Lus10032226 [exp]	3.7	0.9768
AT1G68585			unknown protein		Lus10021686 [exp]	4.2	0.9698
AT4G20090		EMB1025	embryo defective 1025, Pentatr...		Lus10038398 [exp]	4.6	0.9604
AT5G47635			Pollen Ole e 1 allergen and ex...		Lus10038781 [exp]	5.7	0.9633
AT3G16920		ATCTL2	chitinase-like protein 2 (.1)		Lus10037737 [exp]	6.0	0.9732
AT3G55990		TBL29, ESK1	TRICHOME BIREFRINGENCE-LIKE 29...		Lus10030396 [exp]	6.3	0.9746
AT4G22758			unknown protein		Lus10006995 [exp]	7.7	0.9444
AT4G35350		XCP1	xylem cysteine peptidase 1 (.1...		Lus10030722 [exp]	7.9	0.9761

Compare expression of checked genes

Lus10017305 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.