Lus10017311 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64600 143 / 3e-41 methyltransferases;copper ion binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017309 174 / 3e-53 AT1G64600 635 / 0.0 methyltransferases;copper ion binding (.1)
Lus10003205 174 / 5e-53 AT1G64600 636 / 0.0 methyltransferases;copper ion binding (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G086800 144 / 7e-42 AT1G64600 642 / 0.0 methyltransferases;copper ion binding (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22
Representative CDS sequence
>Lus10017311 pacid=23140230 polypeptide=Lus10017311 locus=Lus10017311.g ID=Lus10017311.BGIv1.0 annot-version=v1.0
ATGCCTCGTCGTCTCCGCAGCCTCCGCCGCGCCATCAAAAGATACCTCCGGGAATTGGAGGAGCCACCCATGAAGAAAAAGGTAGGGAGAAGGTCGCCGG
ATTTTTCTCCGTCTAAGGTGCTGGATTTCGGCGCTGGTACTGGTTCAGTTTTCTGGGCTATGAAAGAAGTGTGGCCAAAATCAATCAAGAAGGTTAATCC
GGCGGAACCTTCTCAGTCAATGCAGCGTGCAGGCCGAAGCCTTATTCAAGGAATGAAGGATTTGCCACTTATTCATGGCTATGAAAGCATTCAGGCATTA
AGCAAAAACCTTAAGAAGTCTGAGAGAGAACATGACCTTGTAATTGCTGTAAGTTGTAATTCTTCTCAATTTCTGTAA
AA sequence
>Lus10017311 pacid=23140230 polypeptide=Lus10017311 locus=Lus10017311.g ID=Lus10017311.BGIv1.0 annot-version=v1.0
MPRRLRSLRRAIKRYLRELEEPPMKKKVGRRSPDFSPSKVLDFGAGTGSVFWAMKEVWPKSIKKVNPAEPSQSMQRAGRSLIQGMKDLPLIHGYESIQAL
SKNLKKSEREHDLVIAVSCNSSQFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64600 methyltransferases;copper ion ... Lus10017311 0 1
AT4G01030 pentatricopeptide (PPR) repeat... Lus10017350 6.6 0.7432
AT5G48380 BIR1 BAK1-interacting receptor-like... Lus10036704 14.8 0.7229
AT1G71760 unknown protein Lus10004010 19.5 0.7429
AT1G12240 ATBETAFRUCT4, V... VACUOLAR INVERTASE, Glycosyl h... Lus10004031 20.4 0.6494
AT1G03440 Leucine-rich repeat (LRR) fami... Lus10031601 23.9 0.7127
AT5G10530 Concanavalin A-like lectin pro... Lus10007077 31.1 0.7104
AT3G10080 RmlC-like cupins superfamily p... Lus10020631 31.1 0.7035
AT3G13770 Pentatricopeptide repeat (PPR)... Lus10037798 40.6 0.7061
AT1G15170 MATE efflux family protein (.1... Lus10004899 42.0 0.6006
AT1G72200 RING/U-box superfamily protein... Lus10029794 50.5 0.6030

Lus10017311 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.