Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61820 129 / 2e-36 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003210 [exp] 201 / 7e-64 AT5G61820 431 / 1e-148 unknown protein Lus10017316 [exp] 198 / 6e-63 AT5G61820 436 / 1e-150 unknown protein Lus10042158 [exp] 147 / 2e-43 AT5G61820 415 / 1e-142 unknown protein Lus10004249 [exp] 141 / 4e-41 AT5G61820 435 / 2e-150 unknown protein Lus10015933 [exp] 112 / 3e-30 AT5G61820 306 / 7e-100 unknown protein Lus10033851 [exp] 104 / 5e-27 AT5G61820 316 / 6e-103 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G108500 [exp] 160 / 3e-48 AT5G61820 470 / 2e-163 unknown protein Potri.015G108600 [exp] 157 / 7e-47 AT5G61820 477 / 3e-166 unknown protein Potri.012G110300 [exp] 152 / 5e-46 AT5G61820 366 / 9e-125 unknown protein Potri.015G108700 [exp] 149 / 5e-44 AT5G61820 453 / 5e-157 unknown protein Potri.015G108800 [exp] 148 / 1e-43 AT5G61820 468 / 7e-163 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07712 [flax] [poplar] SURNod19 Stress up-regulated Nod 19
Representative CDS sequence Show only first row Show all	>Lus10017315 pacid=23140273 polypeptide=Lus10017315 locus=Lus10017315.g ID=Lus10017315.BGIv1.0 annot-version=v1.0 ATGAGATCCAGAGGAGCAGGATCGGTGGAGAACAGGATCTACCCGAGCATCGATTTCCCCACAGGCCACGTCAGCATCAAATGCTTCGATGCCGAAGTTG TTGACCATCTCGGGAAACCCATCCCTCCCCACGAAACCTACCTTCACCACTGGGTTCTAGCGAGATACCGCACCGCCAAGGGCAGCGATTCCAGTGGTCT GTGTGTTAGGAACAGCGGGATATGTCAAGGTAACATTCTCGGACAGTACTACCGGCTTGGATCCGAGACGAGGAAGACCTCGACGGGTGTTCTTGATCCT TACGCAATTCCAGTTGGGGATCCTGCTGAGATTCCGGATGGTTACGATCATGCTATTGATACTAGGGGAGTTGTGGACCGATTGGGATGA
AA sequence Show only first row Show all	>Lus10017315 pacid=23140273 polypeptide=Lus10017315 locus=Lus10017315.g ID=Lus10017315.BGIv1.0 annot-version=v1.0 MRSRGAGSVENRIYPSIDFPTGHVSIKCFDAEVVDHLGKPIPPHETYLHHWVLARYRTAKGSDSSGLCVRNSGICQGNILGQYYRLGSETRKTSTGVLDP YAIPVGDPAEIPDGYDHAIDTRGVVDRLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G61820			unknown protein		Lus10017315 [exp]	0	1
AT5G61820			unknown protein		Lus10017316 [exp]	1.0	0.9875
AT4G38540			FAD/NAD(P)-binding oxidoreduct...		Lus10034467 [exp]	2.0	0.9755
AT4G35110			Arabidopsis phospholipase-like...		Lus10026277 [exp]	2.2	0.9647
AT3G47570			Leucine-rich repeat protein ki...		Lus10020140 [exp]	5.2	0.9612
AT2G44180		MAP2A	methionine aminopeptidase 2A (...		Lus10027121 [exp]	5.5	0.9586
AT5G23810		AAP7	amino acid permease 7 (.1.2)		Lus10010580 [exp]	5.7	0.9650
AT2G46680	HD	ATHB7, ATHB-7	ARABIDOPSIS THALIANA HOMEOBOX ...		Lus10008840 [exp]	6.2	0.9659
					Lus10041676 [exp]	8.5	0.9552
AT5G41210		GSTU12, GST10, ...	glutathione S-transferase THET...		Lus10008021 [exp]	8.7	0.9544
AT3G44710			Plant protein of unknown funct...		Lus10020562 [exp]	10.2	0.9622

Compare expression of checked genes

Lus10017315 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.