Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50790 95 / 5e-24 esterase/lipase/thioesterase family protein (.1) AT1G34340 44 / 7e-06 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001673 [exp] 201 / 5e-64 AT3G50790 536 / 0.0 esterase/lipase/thioesterase family protein (.1) Lus10017332 [exp] 126 / 1e-35 AT3G50790 431 / 9e-150 esterase/lipase/thioesterase family protein (.1) Lus10035739 [exp] 42 / 5e-05 AT5G49950 627 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Lus10035744 [exp] 42 / 5e-05 AT5G49950 631 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Lus10037325 [exp] 42 / 6e-05 AT5G49950 627 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Lus10037322 [exp] 42 / 6e-05 AT5G49950 632 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G146500 [exp] 105 / 7e-28 AT3G50790 512 / 0.0 esterase/lipase/thioesterase family protein (.1) Potri.013G115000 [exp] 42 / 5e-05 AT1G34340 629 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.004G223100 [exp] 39 / 0.0005 AT5G49950 648 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017327 pacid=23140212 polypeptide=Lus10017327 locus=Lus10017327.g ID=Lus10017327.BGIv1.0 annot-version=v1.0 ATGGCGCCACTCAGCTGGGGCTCATTACCTACCACTCCTCCATTCCCATTCCACTACCTTCGCCGCTCGTCAAAACCAATCTCCATCGTCCGATTCAGCT CCCCGATGGCTAGCTACACCGATCCTCCTCATCCTCCTCATCCTCTTCCTCCCCACTCCTCATTAGAAGTCTCCGGCGGCGGCAAGGACCTCTTCCTCCC TGCACGCAAGACAATACACCATCCCTACTACGCTTACCCACTCGTCGCCTCCAATCGCCACGTCGAGACCATCTTCGCCTCCTTCTATCGCTCCAAACCC GACGTCAAATACAAGCGAGAGGTCCTCCGTACGAAGGACGACGGCTCCGTTTCCCTCGATTGGGTCTCCGGCGACGAAATTAAATAA
AA sequence Show only first row Show all	>Lus10017327 pacid=23140212 polypeptide=Lus10017327 locus=Lus10017327.g ID=Lus10017327.BGIv1.0 annot-version=v1.0 MAPLSWGSLPTTPPFPFHYLRRSSKPISIVRFSSPMASYTDPPHPPHPLPPHSSLEVSGGGKDLFLPARKTIHHPYYAYPLVASNRHVETIFASFYRSKP DVKYKREVLRTKDDGSVSLDWVSGDEIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G50790			esterase/lipase/thioesterase f...		Lus10017327 [exp]	0	1
AT4G01660		ATABC1, ATATH10...	ABC transporter 1 (.1)		Lus10007202 [exp]	17.3	0.5925
AT1G52190			Major facilitator superfamily ...		Lus10037896 [exp]	18.5	0.6213
AT1G24430			HXXXD-type acyl-transferase fa...		Lus10028813 [exp]	27.8	0.6182
AT3G60380			unknown protein		Lus10042896 [exp]	65.8	0.5891
AT5G17530			phosphoglucosamine mutase fami...		Lus10040402 [exp]	143.0	0.5435
AT4G39050			Kinesin motor family protein (...		Lus10017893 [exp]	278.0	0.5036

Compare expression of checked genes

Lus10017327 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.