Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64700 50 / 3e-08 unknown protein AT3G61920 41 / 5e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001663 [exp] 132 / 2e-39 AT1G64700 138 / 1e-40 unknown protein Lus10008274 [exp] 78 / 1e-18 AT1G64700 118 / 9e-33 unknown protein Lus10030204 [exp] 42 / 2e-05 AT3G61920 59 / 4e-11 unknown protein Lus10002686 [exp] 41 / 2e-05 AT3G61920 57 / 2e-11 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G153000 [exp] 67 / 1e-14 AT1G64700 160 / 1e-49 unknown protein Potri.001G448500 [exp] 65 / 9e-14 AT1G64700 154 / 3e-47 unknown protein Potri.002G178900 [exp] 57 / 4e-11 AT3G61920 142 / 6e-43 unknown protein Potri.014G104900 [exp] 55 / 5e-10 AT3G61920 130 / 4e-38 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017341 pacid=23140154 polypeptide=Lus10017341 locus=Lus10017341.g ID=Lus10017341.BGIv1.0 annot-version=v1.0 ATGTCACTGAACAGATCCTACACCACCGACGCCTTTTCCACCATGTCCAATTCCTCTTCCGCCGCCGCGGTTTCCGCAAACGGGAACGGTAATTATCAGA AGGAGTCTGCAGGGTCGTTCTGGAAAGTGAAGCTGGTGATTAGTCCTGATCAGCTGCTTCAGATTCTGTCTCAAGAAGGGTCGACTGGCGACTTGATCCA CAACGTCACTGCGGTGGCCAAGTGCGGCGGCGGATATTCGTCGTTATCGGTACTTCCGTCTTCTTCTTCCTCCTCGTCGGCGTCGTCGGCGGCTTCTTCC GTCGATGAGCTGTCGGATGAGTGGATTAACTCTACTAATGCTATTAGATCTACTGCGTAG
AA sequence Show only first row Show all	>Lus10017341 pacid=23140154 polypeptide=Lus10017341 locus=Lus10017341.g ID=Lus10017341.BGIv1.0 annot-version=v1.0 MSLNRSYTTDAFSTMSNSSSAAAVSANGNGNYQKESAGSFWKVKLVISPDQLLQILSQEGSTGDLIHNVTAVAKCGGGYSSLSVLPSSSSSSSASSAASS VDELSDEWINSTNAIRSTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64700			unknown protein		Lus10017341 [exp]	0	1
AT4G35040	bZIP	bZIP19	Basic-leucine zipper (bZIP) tr...		Lus10005073 [exp]	1.4	0.9104
AT3G20830			AGC (cAMP-dependent, cGMP-depe...		Lus10031830 [exp]	1.7	0.8994
AT4G38220		AQI	aquaporin interactor, Peptidas...		Lus10026565 [exp]	2.0	0.8975
AT5G24460			unknown protein		Lus10015572 [exp]	2.4	0.9092
					Lus10019698 [exp]	4.5	0.8939
AT1G67330			Protein of unknown function (D...		Lus10006415 [exp]	5.3	0.8830
AT2G16770	bZIP	bZIP23	Basic-leucine zipper (bZIP) tr...		Lus10027847 [exp]	7.7	0.8627
AT4G18700		ATWL4, CIPK12, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10015275 [exp]	8.5	0.8787
AT5G23530		ATCXE18	carboxyesterase 18 (.1)		Lus10039621 [exp]	10.8	0.8590
AT3G18490			Eukaryotic aspartyl protease f...		Lus10042978 [exp]	13.4	0.8684

Compare expression of checked genes

Lus10017341 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.