Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17220 89 / 2e-22 ATPMEI2 pectin methylesterase inhibitor 2 (.1) AT1G48020 87 / 6e-22 ATPMEI1 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1) AT1G50340 59 / 3e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G31430 56 / 6e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G50325 56 / 8e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G02250 52 / 2e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 50 / 6e-08 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT5G46960 50 / 7e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G27999 46 / 2e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46950 45 / 4e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001658 [exp] 280 / 1e-97 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1) Lus10017347 [exp] 216 / 2e-72 AT3G17220 81 / 2e-19 pectin methylesterase inhibitor 2 (.1) Lus10017346 [exp] 180 / 2e-58 AT3G17220 79 / 8e-19 pectin methylesterase inhibitor 2 (.1) Lus10041650 [exp] 144 / 3e-44 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1) Lus10001659 [exp] 132 / 2e-39 AT1G48020 51 / 3e-08 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1) Lus10023114 [exp] 87 / 1e-21 AT3G17220 60 / 2e-11 pectin methylesterase inhibitor 2 (.1) Lus10019498 [exp] 63 / 1e-12 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10008201 [exp] 61 / 1e-11 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10001464 [exp] 59 / 4e-11 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G044100 [exp] 62 / 2e-12 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 61 / 9e-12 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.004G016500 [exp] 60 / 2e-11 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 57 / 3e-10 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.002G191500 [exp] 56 / 7e-10 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G209800 [exp] 53 / 7e-09 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.010G063000 [exp] 52 / 1e-08 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.005G023201 [exp] 53 / 2e-08 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023050 [exp] 52 / 3e-08 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G086500 [exp] 51 / 5e-08 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10017345 pacid=23140222 polypeptide=Lus10017345 locus=Lus10017345.g ID=Lus10017345.BGIv1.0 annot-version=v1.0 ATGACGACATCGTTCGTACTCCTTTCTGTCACGGCGGCCCTCCTCCTATCCCAAACCGTTTGTTATGTGGCGGCCGACCTCCGCATAAGGTTGGCCCCAT CGGACATCGCCGCGATATGCGACAAGAGCATTGACCGCAACTTCTGCCTCAACTTCCTCAAGACGACGCCCGGGATTCCGACCGCGGATCTCAAGGGCGC CGGTCTCATCACCCTGGATGCCGCGCGTGGTGTGGCCGCCGATACGGAGAAGTACATCAACAATTTGTTGGGAAAGACGGCGGACCCCAAGACGAAGGAG AGCTACAAGTCGTGCCTGAGCAGTTACGATGACGCCGTGGACAACATCGAGACGGCCACGGCGTCGCTGAACAGCGGCGACTACAACGGGGCGAACATCC AGGCCTCGGCGGCTCAGACGGATGCCGATGATTGCGAGGACGTCAAGGGATCGGAGCTGCCGAGCAGGAACCAGGATTTCATCAAGGTTCTTGGGATCGT TTTGATAATCGCCAACAAGTTGCTCGGACGTTGA
AA sequence Show only first row Show all	>Lus10017345 pacid=23140222 polypeptide=Lus10017345 locus=Lus10017345.g ID=Lus10017345.BGIv1.0 annot-version=v1.0 MTTSFVLLSVTAALLLSQTVCYVAADLRIRLAPSDIAAICDKSIDRNFCLNFLKTTPGIPTADLKGAGLITLDAARGVAADTEKYINNLLGKTADPKTKE SYKSCLSSYDDAVDNIETATASLNSGDYNGANIQASAAQTDADDCEDVKGSELPSRNQDFIKVLGIVLIIANKLLGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G17220		ATPMEI2	pectin methylesterase inhibito...		Lus10017345 [exp]	0	1
AT1G69630			F-box/RNI-like superfamily pro...		Lus10011410 [exp]	1.0	0.9995
AT4G20270		BAM3	BARELY ANY MERISTEM 3, Leucine...		Lus10043327 [exp]	2.0	0.9869
					Lus10025782 [exp]	2.4	0.9850
AT2G04305			Magnesium transporter CorA-lik...		Lus10035643 [exp]	2.8	0.9782
AT3G49780		ATPSK3(FORMERSY...	phytosulfokine 4 precursor (.1...		Lus10011721 [exp]	3.2	0.9668
					Lus10021407 [exp]	8.5	0.9364
					Lus10038304 [exp]	9.5	0.7809
AT2G19590		ATACO1, ACO1	ACC oxidase 1 (.1)		Lus10032683 [exp]	10.8	0.8988
AT2G47190	MYB	AtMYB2	myb domain protein 2 (.1)		Lus10009996 [exp]	10.9	0.9170
					Lus10027418 [exp]	11.2	0.7892

Compare expression of checked genes

Lus10017345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.