Lus10017347 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17220 80 / 5e-19 ATPMEI2 pectin methylesterase inhibitor 2 (.1)
AT1G48020 79 / 8e-19 ATPMEI1 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
AT5G46960 53 / 5e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G02250 49 / 1e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G27999 49 / 1e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G50340 47 / 8e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G50325 44 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17150 43 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46950 42 / 5e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G55770 41 / 0.0001 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001658 226 / 1e-76 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Lus10017345 219 / 6e-74 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1)
Lus10017346 172 / 2e-55 AT3G17220 79 / 8e-19 pectin methylesterase inhibitor 2 (.1)
Lus10041650 152 / 3e-47 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Lus10001659 140 / 2e-42 AT1G48020 51 / 3e-08 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Lus10023114 89 / 2e-22 AT3G17220 60 / 2e-11 pectin methylesterase inhibitor 2 (.1)
Lus10008201 64 / 6e-13 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10001464 62 / 5e-12 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10019498 54 / 5e-09 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G044100 58 / 7e-11 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.006G134900 54 / 2e-09 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.001G127500 52 / 1e-08 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G209800 50 / 6e-08 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.003G086500 49 / 2e-07 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G086600 47 / 1e-06 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.009G083500 45 / 3e-06 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10017347 pacid=23140250 polypeptide=Lus10017347 locus=Lus10017347.g ID=Lus10017347.BGIv1.0 annot-version=v1.0
ATGGCAAACTCGTCTTTATTCCTCTCGGTCGCTGTCCTCCTCCTCCTATCCCAGACCCTCCCATATGTAGCTCCCTTAGCCCCACAGGAGATCGCCGCGA
TATGCGACCAGAGCCTCGACCGCAACGTCTGCCTCAACTTCCTCGAGACGACGCCCGGAATCTCGACCGCCGATCTCAAGGGCGCCGGTCTCATCACCCT
GGACTCAACACGTGCGGAGGTCGCCGACACGGAGAAGTTCATCAAAAAGCTGTTGGGACATCCCGCTGACCCCAAGATGAAGGAGAGCTACAAGTCGTGC
CTGGAAAGCTATGGCGATGCCTCGGACGACATCGAGGATGCCAAAGCGTCGCTGACTGGCGGCGACTACAACGGCGCTAACATCCAAGCCTCGGCGGCTC
AGACGTTTGTCGACGGTTGCGACGAGGACGTCAAGGGTTCGGAGCTGTCAAAGAGGAACCAGCACTTGTTGAAGGTTCTTGAGATCGTTTTGATCATCGC
TAACAAGTTGATCGGACATTGA
AA sequence
>Lus10017347 pacid=23140250 polypeptide=Lus10017347 locus=Lus10017347.g ID=Lus10017347.BGIv1.0 annot-version=v1.0
MANSSLFLSVAVLLLLSQTLPYVAPLAPQEIAAICDQSLDRNVCLNFLETTPGISTADLKGAGLITLDSTRAEVADTEKFIKKLLGHPADPKMKESYKSC
LESYGDASDDIEDAKASLTGGDYNGANIQASAAQTFVDGCDEDVKGSELSKRNQHLLKVLEIVLIIANKLIGH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G17220 ATPMEI2 pectin methylesterase inhibito... Lus10017347 0 1
AT3G44735 PSK1, ATPSK3 PHYTOSULFOKINE 3 PRECURSOR (.1... Lus10035572 1.0 0.9433
AT1G55840 Sec14p-like phosphatidylinosit... Lus10022533 3.7 0.9132
Lus10025141 4.7 0.9289
AT4G32870 Polyketide cyclase/dehydrase a... Lus10000573 4.9 0.9258
AT5G22580 Stress responsive A/B Barrel D... Lus10020555 8.1 0.9199
Lus10003556 8.7 0.9248
AT4G38810 Calcium-binding EF-hand family... Lus10026291 9.6 0.8839
AT1G48590 Calcium-dependent lipid-bindin... Lus10003710 9.9 0.9061
AT1G60783 unknown protein Lus10004622 10.2 0.9067
AT3G48670 RDM12, IDN2 RNA-DIRECTED DNA METHYLATION 1... Lus10002305 10.2 0.9042

Lus10017347 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.