Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77010 50 / 2e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G71460 48 / 1e-07 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G05340 47 / 2e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G56570 47 / 3e-07 PGN PENTATRICOPEPTIDE REPEAT PROTEIN FOR GERMINATION ON NaCl, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G50270 46 / 4e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G13270 46 / 5e-07 RARE1 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G63370 45 / 1e-06 OTP86 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22070 45 / 1e-06 pentatricopeptide (PPR) repeat-containing protein (.1) AT4G37170 45 / 2e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G14730 44 / 2e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022629 [exp] 52 / 5e-09 AT2G41080 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004003 [exp] 50 / 6e-09 AT3G25970 164 / 6e-48 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10003324 [exp] 51 / 8e-09 AT2G41080 597 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003325 [exp] 51 / 9e-09 AT2G41080 570 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040577 [exp] 49 / 4e-08 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10001187 [exp] 49 / 6e-08 AT3G23070 879 / 0.0 CRM family member 3A (.1) Lus10028106 [exp] 49 / 6e-08 AT1G25360 916 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10031028 [exp] 49 / 7e-08 AT4G19191 727 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10033775 [exp] 48 / 2e-07 AT5G15340 635 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G075200 [exp] 97 / 5e-25 AT1G77010 835 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G131800 [exp] 50 / 2e-08 AT3G50420 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G012500 [exp] 48 / 1e-07 AT3G49710 995 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G014900 [exp] 48 / 1e-07 AT5G59600 334 / 6e-108 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G006700 [exp] 47 / 3e-07 AT1G56570 732 / 0.0 PENTATRICOPEPTIDE REPEAT PROTEIN FOR GERMINATION ON NaCl, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G029900 [exp] 46 / 5e-07 AT5G19020 789 / 0.0 mitochondrial editing factor 18 (.1) Potri.013G058900 [exp] 45 / 7e-07 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G060600 [exp] 45 / 9e-07 AT3G24000 331 / 3e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G010900 [exp] 45 / 2e-06 AT1G56570 666 / 0.0 PENTATRICOPEPTIDE REPEAT PROTEIN FOR GERMINATION ON NaCl, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G044700 [exp] 44 / 2e-06 AT3G22690 582 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017351 pacid=23140234 polypeptide=Lus10017351 locus=Lus10017351.g ID=Lus10017351.BGIv1.0 annot-version=v1.0 ATGGATGCGGAGCTCCATTCTCTGACTCGCTTACTCCAGTCTTTCACCACCCCTCGCTCAATCCGTCAAGGCAAGCAACTCCACTCCCTCTTCTTCAAAA AGGGCGTCTTGAACTCAACAGTATCTCTCGCCAACATGATTCTTCAGATGTACTCTAGGTGTGGTTGCTTGACTGATGCACAGACACTGTTCGATGACTG GCCGAAACTGCTTCTCCTGGAACAGTATGATAGAAGGATATATGAACGCCGGAAACAAAAGGAAGTCGCTGGAATTGTTTGA
AA sequence Show only first row Show all	>Lus10017351 pacid=23140234 polypeptide=Lus10017351 locus=Lus10017351.g ID=Lus10017351.BGIv1.0 annot-version=v1.0 MDAELHSLTRLLQSFTTPRSIRQGKQLHSLFFKKGVLNSTVSLANMILQMYSRCGCLTDAQTLFDDWPKLLLLEQYDRRIYERRKQKEVAGIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G50270			Pentatricopeptide repeat (PPR)...		Lus10017351 [exp]	0	1
AT3G54140		ATPTR1	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10021132 [exp]	3.0	0.8621
AT4G01310			Ribosomal L5P family protein (...		Lus10033169 [exp]	3.2	0.8312
					Lus10029057 [exp]	11.3	0.8552
AT3G25670			Leucine-rich repeat (LRR) fami...		Lus10027239 [exp]	11.5	0.8524
AT4G18210		ATPUP10	purine permease 10 (.1)		Lus10042835 [exp]	12.2	0.8462
AT4G38900	bZIP	AtbZIP29	Basic-leucine zipper (bZIP) tr...		Lus10010616 [exp]	21.4	0.7591
AT1G06330			Heavy metal transport/detoxifi...		Lus10028331 [exp]	22.4	0.7598
AT4G33800			unknown protein		Lus10006135 [exp]	27.7	0.7901
AT1G69120	MADS	AGL7, AP1	APETALA1, AGAMOUS-like 7, K-bo...		Lus10017870 [exp]	32.4	0.7740
AT3G48540			Cytidine/deoxycytidylate deami...		Lus10016755 [exp]	33.5	0.7155

Compare expression of checked genes

Lus10017351 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.