Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61570 82 / 6e-22 TIM13 translocase of the inner mitochondrial membrane 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010147 [exp] 115 / 1e-33 AT2G18196 165 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G452100 [exp] 94 / 1e-26 AT1G61570 76 / 2e-19 translocase of the inner mitochondrial membrane 13 (.1) Potri.011G149800 [exp] 94 / 1e-26 AT1G61570 77 / 3e-20 translocase of the inner mitochondrial membrane 13 (.1) Potri.011G125951 [exp] 40 / 4e-05 AT3G42170 313 / 2e-95 BED zinc finger ;hAT family dimerisation domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [flax] [poplar] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Lus10017352 pacid=23140143 polypeptide=Lus10017352 locus=Lus10017352.g ID=Lus10017352.BGIv1.0 annot-version=v1.0 ATGGATTTCTCCCAACCTGGTGGACAGAGCTCTCAGAGTCCAAACTTATCGACGGAGGAATTCAAGGATCAGTTCAAGACTCAACTTGCCCAGGCCTATG CCCAAGAATTCCTCGAGACATTGGGAACCAAGTGCTTCGACAAGTGCGTGACGAAGCCGGGATCGAGTCTGAGCGGGAGCGAAAGCAGCTGCGTCTCCAG GTGTGTGGATCGCTACATCGAAGCCACTGGCTTAGTTAGCAGAGCTCTCTTCAAAGCTCCCCTCTGA
AA sequence Show only first row Show all	>Lus10017352 pacid=23140143 polypeptide=Lus10017352 locus=Lus10017352.g ID=Lus10017352.BGIv1.0 annot-version=v1.0 MDFSQPGGQSSQSPNLSTEEFKDQFKTQLAQAYAQEFLETLGTKCFDKCVTKPGSSLSGSESSCVSRCVDRYIEATGLVSRALFKAPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61570		TIM13	translocase of the inner mitoc...		Lus10017352 [exp]	0	1
AT2G31610			Ribosomal protein S3 family pr...		Lus10033442 [exp]	1.7	0.8915
AT5G39850			Ribosomal protein S4 (.1)		Lus10042193 [exp]	2.4	0.8712
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10035401 [exp]	3.2	0.8557
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10004648 [exp]	3.9	0.8639
AT5G24840			tRNA (guanine-N-7) methyltrans...		Lus10026965 [exp]	4.2	0.8118
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Lus10012464 [exp]	6.0	0.8375
AT4G15000			Ribosomal L27e protein family ...		Lus10027314 [exp]	6.6	0.8617
AT5G41685			Mitochondrial outer membrane t...		Lus10016473 [exp]	7.1	0.7979
AT3G44620			protein tyrosine phosphatases;...		Lus10019533 [exp]	7.9	0.8461
AT1G60770			Tetratricopeptide repeat (TPR)...		Lus10013047 [exp]	8.2	0.8124

Compare expression of checked genes

Lus10017352 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.