Plant FIBer expression Database

Lus10017381 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23290 192 / 1e-63 PFD5, PDF5 prefoldin 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010176
[exp]
236 / 5e-81 AT5G23290 228 / 4e-78 prefoldin 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G090100
[exp]
202 / 3e-67 AT5G23290 236 / 6e-81 prefoldin 5 (.1)
Potri.007G074042
[exp]
199 / 6e-66 AT5G23290 231 / 4e-79 prefoldin 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0200 Prefoldin PF02996 Prefoldin Prefoldin subunit
Representative CDS sequence
>Lus10017381 pacid=23140139 polypeptide=Lus10017381 locus=Lus10017381.g ID=Lus10017381.BGIv1.0 annot-version=v1.0
ATGGACAAGTTGACCGTGGAACAACTCAAGGCGCTCAAAGAGCAGACGGATCTAGAGGTCAATCTCTTGCAAGACAGTCTCACCAACATTCGCACCGCCA
CCACTCGGCTCGATCTCGCTTCCTCCGCCCTCCACGATCTCTCCCTCCGCCCCCAAGGTAAGAAAATGCTGGTCCCTCTTACTGCGTCACTCTACGTCCC
TGGAACTCTCGATGACTCCGAGAACGTCCTCGTCGATATCGGCACCGGTTATTTTGTCGAGCTTCTTCTTCAGTATGCTCATTTGGCAAGCTTACCGAAC
CTGACTTTTGGCTTTATGTTCTTCTTATCTTTACTTGGTTGGCATCATCAGAAAACAATGGTTGAAGGGAAAGATTATTGCGAAAGGAAGATCAACTTGC
TCAAATCGAATTACGATCAACTTCTTGAGCTTGCATCGAAGAAGAAGAGCGTTGCGGACGAAGCAGGGGTGGTCTTGCAGGCAAAGTTGAAACAGATGGC
AGCACCATCGCCGTAG
AA sequence
>Lus10017381 pacid=23140139 polypeptide=Lus10017381 locus=Lus10017381.g ID=Lus10017381.BGIv1.0 annot-version=v1.0
MDKLTVEQLKALKEQTDLEVNLLQDSLTNIRTATTRLDLASSALHDLSLRPQGKKMLVPLTASLYVPGTLDDSENVLVDIGTGYFVELLLQYAHLASLPN
LTFGFMFFLSLLGWHHQKTMVEGKDYCERKINLLKSNYDQLLELASKKKSVADEAGVVLQAKLKQMAAPSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G23290 PFD5, PDF5 prefoldin 5 (.1) Lus10017381
[exp]
0 1
AT4G12340 copper ion binding (.1) Lus10024588
[exp]
7.9 0.8011
AT1G32330 HSF ATHSFA1D heat shock transcription facto... Lus10030956
[exp]
10.2 0.7340
AT5G58530 Glutaredoxin family protein (.... Lus10017438
[exp]
13.7 0.7552
AT1G27310 NTF2A nuclear transport factor 2A (.... Lus10035202
[exp]
14.1 0.7926
AT3G56130 biotin/lipoyl attachment domai... Lus10010226
[exp]
19.1 0.7527
AT5G01910 unknown protein Lus10025214
[exp]
20.4 0.7190
AT1G62730 Terpenoid synthases superfamil... Lus10032248
[exp]
23.4 0.7400
AT4G12340 copper ion binding (.1) Lus10032225
[exp]
27.5 0.7445
AT3G13160 Tetratricopeptide repeat (TPR)... Lus10018394
[exp]
34.0 0.7397
AT5G58590 RANBP1 RAN binding protein 1 (.1) Lus10037242
[exp]
36.6 0.7290

Lus10017381 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.