Lus10017382 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08320 132 / 7e-40 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010178 219 / 5e-74 AT5G08320 148 / 1e-46 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G090400 133 / 5e-40 AT5G08320 199 / 2e-66 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10238 Eapp_C E2F-associated phosphoprotein
Representative CDS sequence
>Lus10017382 pacid=23140186 polypeptide=Lus10017382 locus=Lus10017382.g ID=Lus10017382.BGIv1.0 annot-version=v1.0
ATGCGTTATTCTGGGTGCCGTATTCCGCCGCCCTTTTCCTCTCTTACAGCAAGGAAACCATACCCGATTCTCAACATGAAGCGCTCCGTTCCGAGTTCGG
TGGCGTCCTCAGACGATGAGGAGACAGACTACAACGCAAAGCTTGAATTCTACGATCCAAAGATCGACGAGAAAGACGAAGCTTGGGTTGGGAAGCAGAA
AGGAGGAAACCGCCGCTCCGACGCCGTCCTCAGCTGCCCTTCTTGCTTCACCACTCTCTGCCTCCAATCCCAGAGGCACGAAACGAATGTGACACAGTAC
AGAGCAATCTTCGTAGTGAACTGCAAGGTGATCAGCAGTAATGATATGCAACTGGACCAACCATCAGATGACATTGCCAGCCATTCAAGTAGTTGCAATA
CTAACAGTGTCGGTGGTGCTACTAGCCGTGAAGCAGCAGGAAGCTCATCAATCAGCTGTTCAGTTTGCTCTGCACAAGTTGGAGTCTTGGACGACGAACA
AGTCTACCATTTCTTCGACGTCATCCCAAGTGAATCTTAA
AA sequence
>Lus10017382 pacid=23140186 polypeptide=Lus10017382 locus=Lus10017382.g ID=Lus10017382.BGIv1.0 annot-version=v1.0
MRYSGCRIPPPFSSLTARKPYPILNMKRSVPSSVASSDDEETDYNAKLEFYDPKIDEKDEAWVGKQKGGNRRSDAVLSCPSCFTTLCLQSQRHETNVTQY
RAIFVVNCKVISSNDMQLDQPSDDIASHSSSCNTNSVGGATSREAAGSSSISCSVCSAQVGVLDDEQVYHFFDVIPSES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08320 unknown protein Lus10017382 0 1
AT5G44090 Calcium-binding EF-hand family... Lus10008247 8.8 0.8806
AT1G10710 PHS1 poor homologous synapsis 1 (.1... Lus10018084 14.6 0.8722
AT1G28560 SRD2 SHOOT REDIFFERENTIATION DEFECT... Lus10041957 15.1 0.8783
AT1G04590 EMB2748 unknown protein Lus10019008 21.7 0.8699
AT3G47160 RING/U-box superfamily protein... Lus10001209 25.5 0.8693
AT5G27990 Pre-rRNA-processing protein TS... Lus10002404 27.7 0.8293
AT1G79020 Enhancer of polycomb-like tran... Lus10034778 32.6 0.8431
AT5G46410 SSP4 SCP1-like small phosphatase 4 ... Lus10004551 39.9 0.8607
AT3G53270 Small nuclear RNA activating c... Lus10024665 40.1 0.8586
AT5G63460 SAP domain-containing protein ... Lus10022457 42.8 0.8486

Lus10017382 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.