Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19950 117 / 3e-33 RING/U-box superfamily protein (.1) AT4G26400 89 / 3e-22 RING/U-box superfamily protein (.1.2) AT5G56340 89 / 4e-22 ATCRT1 RING/U-box superfamily protein (.1) AT2G40830 88 / 4e-22 RHC1A RING-H2 finger C1A (.1.2.3) AT3G13430 87 / 1e-21 RING/U-box superfamily protein (.1.2.3) AT5G08139 85 / 1e-20 RING/U-box superfamily protein (.1) AT3G56580 84 / 2e-20 RING/U-box superfamily protein (.1.2.3) AT3G46620 83 / 5e-20 zinc finger (C3HC4-type RING finger) family protein (.1) AT1G55530 83 / 5e-20 RING/U-box superfamily protein (.1) AT1G60360 82 / 1e-19 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010179 [exp] 158 / 2e-49 AT3G19950 285 / 6e-96 RING/U-box superfamily protein (.1) Lus10030755 [exp] 88 / 5e-22 AT2G40830 336 / 2e-115 RING-H2 finger C1A (.1.2.3) Lus10013235 [exp] 88 / 6e-22 AT2G40830 334 / 7e-115 RING-H2 finger C1A (.1.2.3) Lus10040783 [exp] 86 / 3e-21 AT5G59550 228 / 1e-72 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10001582 [exp] 84 / 3e-21 AT2G40830 178 / 2e-55 RING-H2 finger C1A (.1.2.3) Lus10008874 [exp] 86 / 8e-21 AT5G08139 198 / 3e-59 RING/U-box superfamily protein (.1) Lus10023235 [exp] 86 / 9e-21 AT5G08139 194 / 7e-58 RING/U-box superfamily protein (.1) Lus10040278 [exp] 84 / 1e-20 AT5G59550 224 / 2e-71 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10003698 [exp] 84 / 2e-20 AT2G40830 263 / 5e-87 RING-H2 finger C1A (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G036700 [exp] 106 / 8e-29 AT3G19950 273 / 5e-90 RING/U-box superfamily protein (.1) Potri.005G090500 [exp] 105 / 1e-28 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1) Potri.015G028400 [exp] 105 / 3e-28 AT3G19950 256 / 2e-83 RING/U-box superfamily protein (.1) Potri.007G074014 [exp] 103 / 3e-28 AT3G19950 278 / 5e-93 RING/U-box superfamily protein (.1) Potri.003G223200 [exp] 89 / 6e-22 AT5G56340 301 / 3e-99 RING/U-box superfamily protein (.1) Potri.001G243300 [exp] 87 / 1e-21 AT3G46620 239 / 8e-76 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.006G032100 [exp] 86 / 4e-21 AT2G40830 327 / 1e-111 RING-H2 finger C1A (.1.2.3) Potri.019G032500 [exp] 86 / 4e-21 AT5G56340 177 / 1e-51 RING/U-box superfamily protein (.1) Potri.016G029300 [exp] 85 / 5e-21 AT2G40830 317 / 9e-108 RING-H2 finger C1A (.1.2.3) Potri.013G060500 [exp] 86 / 6e-21 AT1G55530 207 / 2e-64 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [flax] [poplar] RING PF00097 [flax] [poplar] zf-C3HC4 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Lus10017383 pacid=23140238 polypeptide=Lus10017383 locus=Lus10017383.g ID=Lus10017383.BGIv1.0 annot-version=v1.0 ATGAATCAGTGTGCTGTTTGTAAGGATGAGTTTGAGAAAGGTGCTGAAGCCAAACAGATGCCTTGTAAGCATCTCTACCATCGAGATTGTATTGTTCCGT GGCTTGAGTTGCATAATTCTTGCCCTGTTTGCCGGCTCGAATTGCCAACCGATGATACTGATTATGAGAATGCGAGGCGCAACGGCGGCGATCAGGGGAA TAACCAAGGCCCTGCTGACGCAGGAGGTCGGTCTGGGAGAAGCTTTAGTATTTCGTTGCCGTGGTCTTTCACCAGGCAGGGTGGTTCCAGCAGTGATGGT GGAGCTGGTGGTGGTCAAAGTAGTTCTTGA
AA sequence Show only first row Show all	>Lus10017383 pacid=23140238 polypeptide=Lus10017383 locus=Lus10017383.g ID=Lus10017383.BGIv1.0 annot-version=v1.0 MNQCAVCKDEFEKGAEAKQMPCKHLYHRDCIVPWLELHNSCPVCRLELPTDDTDYENARRNGGDQGNNQGPADAGGRSGRSFSISLPWSFTRQGGSSSDG GAGGGQSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19950			RING/U-box superfamily protein...		Lus10017383 [exp]	0	1
AT5G13860		ELC-LIKE, ATELC...	ELCH-like (.1)		Lus10024108 [exp]	4.4	0.8135
AT5G13860		ELC-LIKE, ATELC...	ELCH-like (.1)		Lus10026129 [exp]	8.4	0.7937
AT5G59550			zinc finger (C3HC4-type RING f...		Lus10040783 [exp]	8.5	0.8095
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10002853 [exp]	13.2	0.8036
AT3G55730	MYB	ATMYB109	myb domain protein 109 (.1)		Lus10028250 [exp]	13.9	0.7498
AT2G31200		ADF6, ATADF6	actin depolymerizing factor 6 ...		Lus10022933 [exp]	20.9	0.7874
AT3G63000		NPL41	NPL4-like protein 1 (.1)		Lus10017163 [exp]	21.3	0.8012
AT1G12440			A20/AN1-like zinc finger famil...		Lus10007015 [exp]	22.2	0.7536
AT1G10140			Uncharacterised conserved prot...		Lus10018665 [exp]	22.8	0.7435
AT1G73500		ATMKK9	MAP kinase kinase 9 (.1)		Lus10040127 [exp]	22.9	0.7757

Compare expression of checked genes

Lus10017383 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.