Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08305 146 / 9e-43 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G13770 114 / 6e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G03380 110 / 1e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G14330 110 / 2e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G04750 110 / 3e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G39350 109 / 7e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G50270 107 / 2e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G21065 105 / 5e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G08820 106 / 7e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G20230 106 / 8e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010183 [exp] 228 / 4e-74 AT5G08305 529 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10029853 [exp] 114 / 4e-31 AT1G09190 575 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030225 [exp] 111 / 2e-30 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10005987 [exp] 111 / 7e-30 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10031423 [exp] 111 / 1e-29 AT5G66520 538 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010909 [exp] 110 / 2e-29 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029344 [exp] 110 / 3e-29 AT5G06540 803 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10030415 [exp] 108 / 1e-28 AT1G69350 814 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040504 [exp] 105 / 1e-27 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G073100 [exp] 164 / 2e-49 AT5G08305 600 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G051300 [exp] 114 / 1e-30 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G237000 [exp] 112 / 3e-30 AT5G66520 544 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G065500 [exp] 112 / 4e-30 AT5G06540 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G053600 [exp] 111 / 9e-30 AT3G04750 759 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G012600 [exp] 110 / 2e-29 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G006400 [exp] 110 / 3e-29 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G175900 [exp] 109 / 5e-29 AT5G08510 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G005400 [exp] 108 / 9e-29 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.008G093000 [exp] 108 / 1e-28 AT1G69350 832 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10017387 pacid=23140215 polypeptide=Lus10017387 locus=Lus10017387.g ID=Lus10017387.BGIv1.0 annot-version=v1.0 ATGACTGCTAAGAGCGAGCATTACGCTTGTATGGTTGATATGCTAGCTCGTGCGGGTCAGGTAACAGAGGCTTACGAATTGGTAATTAACCGAATGCCAA TGGAGCCAACTGCTTCAATGCTGGGAGCTCTGTTCAACGGGTGCATGAGCCACAAAAGACTCGACCTTGCTGAGATAGTTGGACGGAAGCTGATCCAGAT TCAGCCTGATAACGACGGTAGATATGTCGGGCTGTCGAATGTTTACGCAGAGGTGAGACGGTGGGATCAGTGCAGAAACACCAGAGAAGAAATGGAAAAG AAAGGGGTCAAGAAAGCTGCTGGGTATAGTCTCGTTCTTTAA
AA sequence Show only first row Show all	>Lus10017387 pacid=23140215 polypeptide=Lus10017387 locus=Lus10017387.g ID=Lus10017387.BGIv1.0 annot-version=v1.0 MTAKSEHYACMVDMLARAGQVTEAYELVINRMPMEPTASMLGALFNGCMSHKRLDLAEIVGRKLIQIQPDNDGRYVGLSNVYAEVRRWDQCRNTREEMEK KGVKKAAGYSLVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08305			Pentatricopeptide repeat (PPR)...		Lus10017387 [exp]	0	1
AT5G66520			Tetratricopeptide repeat (TPR)...		Lus10038396 [exp]	6.6	0.7731
AT3G63090			Ubiquitin carboxyl-terminal hy...		Lus10028012 [exp]	8.2	0.6766
AT5G08305			Pentatricopeptide repeat (PPR)...		Lus10010183 [exp]	10.7	0.7338
AT3G55605			Mitochondrial glycoprotein fam...		Lus10001017 [exp]	14.6	0.7474
AT3G23710		AtTic22-III	translocon at the inner envelo...		Lus10022378 [exp]	18.5	0.7193
AT3G55605			Mitochondrial glycoprotein fam...		Lus10001015 [exp]	21.7	0.7285
AT5G52630		MEF1	mitochondrial RNAediting facto...		Lus10011323 [exp]	22.6	0.7208
AT5G15780			Pollen Ole e 1 allergen and ex...		Lus10034365 [exp]	24.1	0.7143
AT5G66500			Tetratricopeptide repeat (TPR)...		Lus10041770 [exp]	29.0	0.7324
AT5G13050		5-FCL	5-formyltetrahydrofolate cyclo...		Lus10010736 [exp]	30.0	0.6895

Compare expression of checked genes

Lus10017387 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.