Lus10017390 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08290 290 / 1e-102 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
AT3G24730 94 / 4e-25 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010188 294 / 3e-104 AT5G08290 293 / 4e-104 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Lus10022811 98 / 7e-27 AT3G24730 261 / 7e-91 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Lus10011878 95 / 2e-25 AT3G24730 258 / 1e-89 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Lus10010189 91 / 1e-24 AT5G08290 87 / 4e-23 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G072700 293 / 6e-104 AT5G08290 293 / 5e-104 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Potri.001G287600 80 / 1e-19 AT3G24730 245 / 8e-85 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF02966 DIM1 Mitosis protein DIM1
Representative CDS sequence
>Lus10017390 pacid=23140194 polypeptide=Lus10017390 locus=Lus10017390.g ID=Lus10017390.BGIv1.0 annot-version=v1.0
ATGTCGTACCTGCTACCACACCTGCACTCGGGATGGGCGGTGGATCAGGCGATTCTGGCGGAGGAGGAGCGGGTCGTCGTCATCCGCTTCGGCCACGACT
GGGACGACACTTGTATGCAGATGGATGAAGTGTTGGCGGGAGTTGCTGATACACTGAAGAACTTTGCGGTGATCTACTTGGTGGATATCACAGAGGTGCC
TGATTTCAACACAATGTACGAGCTGTACGATCCATCGACTGTCATGTTCTTCTTCAGGAACAAGCATATCATGATCGATCTGGGAACTGGAAACAACAAC
AAGATCAACTGGGCTCTCAAGGACAAGCAGGAGTTCATCGACATTGTCGAGACAGTTTACCGCGGGGCTAGGAAGGGGCGTGGTCTGGTTATCGCTCCTA
AAGACTACTCGACCAAGTACCGGTACTAG
AA sequence
>Lus10017390 pacid=23140194 polypeptide=Lus10017390 locus=Lus10017390.g ID=Lus10017390.BGIv1.0 annot-version=v1.0
MSYLLPHLHSGWAVDQAILAEEERVVVIRFGHDWDDTCMQMDEVLAGVADTLKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNN
KINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08290 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, m... Lus10017390 0 1
AT4G25270 OTP70 organelle transcript processin... Lus10031714 1.0 0.9018
AT1G56423 unknown protein Lus10029844 2.4 0.8988
AT1G27695 glycine-rich protein (.1.2) Lus10032855 2.4 0.8781
AT3G50830 ATCOR413-PM2, C... cold-regulated 413-plasma memb... Lus10023833 2.6 0.8740
AT5G11900 Translation initiation factor ... Lus10024986 3.9 0.8785
AT1G64750 DSS1(I), ATDSS1... deletion of SUV3 suppressor 1(... Lus10030583 4.5 0.8814
AT2G44850 unknown protein Lus10028204 4.9 0.8734
AT5G07840 PIA1 phytochrome interacting ankyri... Lus10018958 5.2 0.8865
AT3G59280 TXR1 THAXTOMIN A RESISTANT 1, Prote... Lus10043207 6.6 0.8639
AT4G35980 unknown protein Lus10041889 6.7 0.8697

Lus10017390 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.