Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017410 pacid=23140253 polypeptide=Lus10017410 locus=Lus10017410.g ID=Lus10017410.BGIv1.0 annot-version=v1.0 ATGAGCGACACAGCAGCTCTTTGCAGCTACAGGAGTAAGGTTTCCGGCGGTTTCGAAGCTCTGACTGGTTTCGGCGTCACAGTGCGGAAAGAGGTTTTAG CTGCGGCTGAGCTCTGGTTTAATCCGTATGATCGCAATGCAGTGAAGTTAAGGCACGGTGAGCTGATTTTCTTGGCGATGCTTCCACCGTTTTAG
AA sequence Show only first row Show all	>Lus10017410 pacid=23140253 polypeptide=Lus10017410 locus=Lus10017410.g ID=Lus10017410.BGIv1.0 annot-version=v1.0 MSDTAALCSYRSKVSGGFEALTGFGVTVRKEVLAAAELWFNPYDRNAVKLRHGELIFLAMLPPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017410 [exp]	0	1
					Lus10041736 [exp]	1.0	0.9146
AT5G55930		ATOPT1	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10004237 [exp]	1.4	0.8025
AT3G62830		ATUXS2, UXS2, A...	UDP-GLUCURONIC ACID DECARBOXYL...		Lus10037499 [exp]	2.8	0.7225
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004855 [exp]	7.3	0.7925
AT4G03220			Protein with RNI-like/FBD-like...		Lus10018509 [exp]	7.4	0.6268
					Lus10007414 [exp]	10.0	0.6902
AT2G48140		EDA4	embryo sac development arrest ...		Lus10042613 [exp]	12.1	0.6777
AT3G26660	AS2	LBD24	LOB domain-containing protein ...		Lus10023434 [exp]	13.0	0.5835
AT4G30590		AtENODL12	early nodulin-like protein 12 ...		Lus10019955 [exp]	13.1	0.6570
AT1G62660			Glycosyl hydrolases family 32 ...		Lus10030278 [exp]	14.4	0.6736

Compare expression of checked genes

Lus10017410 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.