Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40390 118 / 2e-32 unknown protein AT5G64190 111 / 5e-30 unknown protein AT2G15020 40 / 0.0001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010225 [exp] 193 / 1e-60 AT2G40390 555 / 0.0 unknown protein Lus10009844 [exp] 183 / 5e-57 AT2G40390 517 / 0.0 unknown protein Lus10013880 [exp] 39 / 0.0002 AT2G15020 516 / 1e-179 unknown protein Lus10026592 [exp] 38 / 0.0007 AT2G15020 518 / 2e-180 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G183100 [exp] 152 / 5e-45 AT2G40390 590 / 0.0 unknown protein Potri.009G094100 [exp] 58 / 6e-11 AT2G15020 592 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017423 pacid=23140172 polypeptide=Lus10017423 locus=Lus10017423.g ID=Lus10017423.BGIv1.0 annot-version=v1.0 ATGGGACTCAAGCTTTCGGCCGGGGAAACAGTGTCAATGAGCCTGAAACCGTGGAAATTTGAAGGCTCTGTGTATGCCTACAGTGCAGTTTTCAGCTGGT TTCTTCATGATAACGTGGATGGCAGGGAGGTAGTGTCCTCCAAACCATCACCTTTGGCGCTGATCAATCCTAAATCCTGGTTCAAGGACAGGTACAGAAC GGCTTACCGGCCGTTTACAAGGCAAGGAAGGGTGGCGTTTGCCGGGAGTGAATATGGGAAGAGCATAACCTGGAAAGTGGACAATGGAGTTCGAGATCAG GGGGTGGATTTGGCTAATGTATTGGCCTAA
AA sequence Show only first row Show all	>Lus10017423 pacid=23140172 polypeptide=Lus10017423 locus=Lus10017423.g ID=Lus10017423.BGIv1.0 annot-version=v1.0 MGLKLSAGETVSMSLKPWKFEGSVYAYSAVFSWFLHDNVDGREVVSSKPSPLALINPKSWFKDRYRTAYRPFTRQGRVAFAGSEYGKSITWKVDNGVRDQ GVDLANVLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40390			unknown protein		Lus10017423 [exp]	0	1
AT1G76860			Small nuclear ribonucleoprotei...		Lus10011293 [exp]	4.9	0.8209
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10033547 [exp]	8.2	0.7976
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10030353 [exp]	8.9	0.7877
AT1G67785			unknown protein		Lus10042077 [exp]	11.1	0.8135
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10021405 [exp]	13.5	0.8033
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10031568 [exp]	18.7	0.7784
AT3G18650	MADS	AGL103	AGAMOUS-like 103 (.1)		Lus10024347 [exp]	20.3	0.7316
AT5G13340			unknown protein		Lus10035960 [exp]	20.6	0.7974
AT3G51150			ATP binding microtubule motor ...		Lus10033920 [exp]	22.4	0.7289
AT2G27470	CCAAT	NF-YB11	"nuclear factor Y, subunit B11...		Lus10020621 [exp]	23.1	0.7658

Compare expression of checked genes

Lus10017423 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.