Lus10017425 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56110 196 / 2e-63 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT5G05380 188 / 3e-60 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT2G38360 182 / 1e-57 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT2G40380 159 / 7e-49 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT5G01640 152 / 7e-46 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT5G07110 120 / 2e-33 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
AT1G55190 67 / 1e-13 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G08770 59 / 1e-10 PRA1.E prenylated RAB acceptor 1.E (.1)
AT3G13720 58 / 3e-10 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G17700 57 / 4e-10 PRA1.F1 prenylated RAB acceptor 1.F1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007533 256 / 7e-87 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10009842 231 / 4e-77 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1)
Lus10012224 184 / 1e-58 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1)
Lus10002853 180 / 1e-56 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
Lus10042246 171 / 8e-53 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10026404 158 / 3e-48 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1)
Lus10022680 113 / 1e-31 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1)
Lus10018774 80 / 3e-18 AT1G08770 130 / 5e-38 prenylated RAB acceptor 1.E (.1)
Lus10014234 76 / 3e-17 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G074000 199 / 9e-65 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.008G074033 199 / 9e-65 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.010G183300 192 / 6e-62 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.016G126400 160 / 4e-49 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Potri.006G104400 148 / 1e-44 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Potri.019G124100 142 / 4e-42 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1)
Potri.005G219100 89 / 9e-22 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G054700 86 / 2e-20 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
Potri.002G044000 82 / 3e-19 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G043800 76 / 5e-17 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Lus10017425 pacid=23140201 polypeptide=Lus10017425 locus=Lus10017425.g ID=Lus10017425.BGIv1.0 annot-version=v1.0
ATGGCTGCACCTCCTCTCCCGATCACCAATCCATCGTCCCAGGCTGCTGAATCTCAGCCTCCGATCGCTACACCAGCCTTCCGCAGCTTCATCTCCCGAA
TCTCCACTTCCGTCCGCCAAGGCTTCTCCCAGCGCCGCCCTTGGTTGGAGCTCGTCGACCGATCCGCATTCACCAAGCCGGAATCTCTCACCGAAGCCGC
CGCCCGGATCCGGAAGAACTCGGCTTACTTCAAGGTCAATTACATTTCAATGCTCGTAGTCGTCCTCGCATTCTCCCTACTCTCCCATCCTTTCTCCTTG
CTCGTGCTCCTCTCGCTCCTCGCGTCCTGGATCTTTCTCTACCTCTTCCGCCCTTCGGATCAGCCGGTGGTGATCCTCGGCCGCACCTTCTCGGAGCGGG
AGACGCTCGGCGTGTTGCTCGTTTCTACTGTTGTCGTAGTTTTCTTGACCAGCGTTGGGTCGCTCTTGATCTCGGCGCTGATGGCAGGAGTTGCGATCGT
GTGCGTGCATGGTGCGTTCAGGGTTCCGGAAGATCTATTCCTTGACGAGCAGGAGCCTGCCAATGCTGGACTGCTTTCCTTCCTCGGCGGTGCAGCCTCC
TCTGCCGNNNNNNNNNNNNCCTCCTCTCCCGCCGCAGCTGCTGCTCCAGTTGTTGCCGGTCGCGTATGA
AA sequence
>Lus10017425 pacid=23140201 polypeptide=Lus10017425 locus=Lus10017425.g ID=Lus10017425.BGIv1.0 annot-version=v1.0
MAAPPLPITNPSSQAAESQPPIATPAFRSFISRISTSVRQGFSQRRPWLELVDRSAFTKPESLTEAAARIRKNSAYFKVNYISMLVVVLAFSLLSHPFSL
LVLLSLLASWIFLYLFRPSDQPVVILGRTFSERETLGVLLVSTVVVVFLTSVGSLLISALMAGVAIVCVHGAFRVPEDLFLDEQEPANAGLLSFLGGAAS
SAXXXXXSSPAAAAAPVVAGRV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10017425 0 1
AT1G29790 S-adenosyl-L-methionine-depend... Lus10025384 1.4 0.9466
AT3G44150 unknown protein Lus10016181 1.7 0.9455
AT3G45230 hydroxyproline-rich glycoprote... Lus10041306 1.7 0.9507
AT3G48680 AtCAL2, GAMMACA... gamma carbonic anhydrase-like ... Lus10031845 2.2 0.9337
AT3G45230 hydroxyproline-rich glycoprote... Lus10037404 2.6 0.9263
AT5G57460 unknown protein Lus10000167 3.5 0.9339
AT2G26110 Protein of unknown function (D... Lus10024988 3.5 0.9121
AT1G11360 Adenine nucleotide alpha hydro... Lus10037867 5.5 0.9188
AT5G18520 Lung seven transmembrane recep... Lus10009065 6.9 0.9302
AT5G45420 MYB maMYB membrane anchored MYB, Duplica... Lus10039841 8.0 0.9237

Lus10017425 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.