Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05500 129 / 4e-38 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT2G34700 56 / 7e-10 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 54 / 3e-09 Pollen Ole e 1 allergen and extensin family protein (.1) AT2G33790 54 / 4e-09 ATAGP30 arabinogalactan protein 30 (.1) AT5G41050 47 / 1e-06 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007515 [exp] 325 / 2e-115 AT5G05500 127 / 3e-37 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10009837 [exp] 195 / 7e-64 AT5G05500 171 / 1e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10040948 [exp] 194 / 1e-63 AT5G05500 176 / 9e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10015434 [exp] 72 / 4e-15 AT1G28290 135 / 1e-39 arabinogalactan protein 31 (.1.2) Lus10014013 [exp] 67 / 1e-13 AT2G34700 137 / 2e-40 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10023887 [exp] 49 / 4e-07 AT3G09925 167 / 4e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041926 [exp] 47 / 2e-06 AT4G02270 100 / 5e-26 root hair specific 13 (.1) Lus10008615 [exp] 43 / 3e-05 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042201 [exp] 43 / 3e-05 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G185400 [exp] 157 / 4e-49 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.008G072000 [exp] 138 / 1e-41 AT5G05500 152 / 5e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G053600 [exp] 71 / 5e-15 AT2G34700 139 / 5e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G044700 [exp] 65 / 6e-13 AT2G34700 142 / 8e-43 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.006G119100 [exp] 54 / 4e-09 AT3G09925 180 / 7e-58 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G068400 [exp] 51 / 2e-08 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G145800 [exp] 51 / 5e-08 AT4G02270 118 / 5e-33 root hair specific 13 (.1) Potri.001G326200 [exp] 50 / 6e-08 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126300 [exp] 49 / 4e-07 AT2G47540 114 / 1e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126500 [exp] 47 / 2e-06 AT2G47540 113 / 6e-30 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10017440 pacid=23140229 polypeptide=Lus10017440 locus=Lus10017440.g ID=Lus10017440.BGIv1.0 annot-version=v1.0 ATGGCAGCCAACAACCATCTGATCAAAGCTTCCATTTGCTCTCTCTTCCTCCTCACAATCACAGCCTTCCCATCATCATCATCAGCATCAACTGAAGAAC ATTATTATGTCCCGATTCCGAAACAGAACATCATATCAGTCGTGGTAGTCGAAGGAATCGTCTACTGCCAGAAATGCCAGAATCCTGGCTCCTTGACAGG TGCTACTCCGATCCCTTATGCTAAAGTCAACGTCAATTGCAGGAACTCGCGCCACATGTTGACCTTCCAGAAGGTATACACTGCGAACCAACACGGCTAC TTCTTTGCTCAGCTAGATGGCTTCAGGTTAGGCCACGGAATTTTCGACATTCCACCTCTCCAAGCCTGCACTGCCAAGCTTGTTTCGTCTCCTCTCCGAT CCTGCAATGTAGCTACGGAGATTAACTCTGGACCCTACGGAGCTACGCTCCGGTCCGAGAACAAGGTGTACAAGTACCCTCCGTACGAGACTGTTATCTA TGCGGCTGGTCCTCTCGCTTTCCGGCCTAGTAATTGTTACTGA
AA sequence Show only first row Show all	>Lus10017440 pacid=23140229 polypeptide=Lus10017440 locus=Lus10017440.g ID=Lus10017440.BGIv1.0 annot-version=v1.0 MAANNHLIKASICSLFLLTITAFPSSSSASTEEHYYVPIPKQNIISVVVVEGIVYCQKCQNPGSLTGATPIPYAKVNVNCRNSRHMLTFQKVYTANQHGY FFAQLDGFRLGHGIFDIPPLQACTAKLVSSPLRSCNVATEINSGPYGATLRSENKVYKYPPYETVIYAAGPLAFRPSNCY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05500		MOP10	Pollen Ole e 1 allergen and ex...		Lus10017440 [exp]	0	1
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Lus10015580 [exp]	5.2	0.7744
AT5G35200			ENTH/ANTH/VHS superfamily prot...		Lus10003642 [exp]	11.9	0.7893
AT5G25120		CYP71B11	"ytochrome p450, family 71, su...		Lus10026252 [exp]	22.9	0.7682
AT3G12720	MYB	ATMYB67, AtY53	myb domain protein 67 (.1)		Lus10001226 [exp]	48.1	0.7353
AT4G23290		CRK21	cysteine-rich RLK (RECEPTOR-li...		Lus10028026 [exp]	57.1	0.7507
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10028914 [exp]	58.0	0.7491
AT1G18530			EF hand calcium-binding protei...		Lus10039961 [exp]	71.0	0.7404
AT4G14570		AtAARE, AARE	acylamino acid-releasing enzym...		Lus10039405 [exp]	77.9	0.7445
AT1G59730		ATH7	thioredoxin H-type 7 (.1)		Lus10036696 [exp]	164.7	0.6868
AT4G25560	MYB	LAF1, ATMYB18	LONG AFTER FAR-RED LIGHT 1, my...		Lus10039213 [exp]	166.5	0.7019

Compare expression of checked genes

Lus10017440 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.