Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037925 [exp] 63 / 1e-13 AT5G02420 47 / 2e-07 unknown protein Lus10038653 [exp] 58 / 9e-12 AT5G02420 47 / 2e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G029600 [exp] 60 / 1e-12 AT5G02420 48 / 5e-08 unknown protein Potri.010G231600 [exp] 54 / 4e-10 AT5G02420 44 / 1e-06 unknown protein Potri.010G231700 [exp] 44 / 2e-06 AT5G04470 / SIAMESE, cyclin-dependent protein kinase inhibitors (.1) Potri.001G212300 [exp] 42 / 1e-05 AT5G02420 43 / 8e-06 unknown protein Potri.009G003400 [exp] 37 / 0.0007 AT5G02420 45 / 7e-07 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017454 pacid=23163114 polypeptide=Lus10017454 locus=Lus10017454.g ID=Lus10017454.BGIv1.0 annot-version=v1.0 ATGTCTACCGATCTCGATTCCCGTCCCCAAATCGGAGCTCCGATCAAATTCAGAGCAACAGCACCGGCTGTTTCCAGCAGCAGCGACGACGCCGTCGGCG CAAACAATAAATCTTCAGCTGCTGATGAGAAACCTCTGGCGGTAATCAAAAACATCAACGAAGATCCGGACTGCAACACCCCGGTGAGGGACGAATTCAA GATCCCGGAGGTGCGGTGCTGCCCGCCGCCGCCGAAGAAGCCGAAGAGGATCAGCACCACCGTGGCCTGCAAGAGGAAGCTGCTGTCCGATTTCAGCTTC TTCGACATGATCAACAGGGAGGAAGTCGATTCTCTGTTCCGATCCGTGGAGAAGCGGATGTGTCCCGCTCCAATTCAGCGGTAG
AA sequence Show only first row Show all	>Lus10017454 pacid=23163114 polypeptide=Lus10017454 locus=Lus10017454.g ID=Lus10017454.BGIv1.0 annot-version=v1.0 MSTDLDSRPQIGAPIKFRATAPAVSSSSDDAVGANNKSSAADEKPLAVIKNINEDPDCNTPVRDEFKIPEVRCCPPPPKKPKRISTTVACKRKLLSDFSF FDMINREEVDSLFRSVEKRMCPAPIQR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017454 [exp]	0	1
AT1G11360			Adenine nucleotide alpha hydro...		Lus10039730 [exp]	1.4	0.8549
AT5G40250			RING/U-box superfamily protein...		Lus10014526 [exp]	2.8	0.8301
AT4G14380			unknown protein		Lus10021182 [exp]	3.2	0.8484
AT1G79340		AtMCP2d, ATMC4	metacaspase 2d, metacaspase 4 ...		Lus10001835 [exp]	3.2	0.8324
AT3G52710			unknown protein		Lus10022708 [exp]	4.2	0.8316
AT2G46490			unknown protein		Lus10019579 [exp]	4.5	0.7799
AT1G11360			Adenine nucleotide alpha hydro...		Lus10031594 [exp]	4.6	0.8380
AT4G29350		PRF2, PFN2, PRO...	profilin 2 (.1)		Lus10012936 [exp]	4.6	0.8314
AT5G23340			RNI-like superfamily protein (...		Lus10040998 [exp]	6.3	0.8167
AT2G20230			Tetraspanin family protein (.1...		Lus10022841 [exp]	6.9	0.8350

Compare expression of checked genes

Lus10017454 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.