Lus10017456 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59910 189 / 5e-63 HTB4 Histone superfamily protein (.1)
AT1G07790 188 / 2e-62 HTB1 Histone superfamily protein (.1)
AT3G45980 188 / 2e-62 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT3G46030 187 / 2e-62 HTB11 Histone superfamily protein (.1)
AT5G02570 186 / 8e-62 Histone superfamily protein (.1)
AT2G28720 186 / 8e-62 Histone superfamily protein (.1)
AT3G53650 184 / 7e-61 Histone superfamily protein (.1)
AT2G37470 183 / 1e-60 Histone superfamily protein (.1)
AT5G22880 183 / 2e-60 HTB2, H2B HISTONE H2B, histone B2 (.1)
AT3G09480 167 / 1e-54 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040855 191 / 8e-64 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1)
Lus10005897 190 / 5e-63 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Lus10005893 189 / 5e-63 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1)
Lus10037371 188 / 1e-62 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10016156 188 / 2e-62 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Lus10041347 187 / 2e-62 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10023753 187 / 3e-62 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Lus10017292 187 / 4e-62 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10013544 187 / 4e-62 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G230701 196 / 9e-66 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.008G030400 193 / 2e-64 AT5G59910 191 / 2e-63 Histone superfamily protein (.1)
Potri.010G231300 191 / 1e-63 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.008G030500 190 / 2e-63 AT5G59910 190 / 4e-63 Histone superfamily protein (.1)
Potri.010G230801 190 / 2e-63 AT1G07790 205 / 2e-69 Histone superfamily protein (.1)
Potri.010G230600 190 / 2e-63 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
Potri.008G029900 190 / 3e-63 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.017G123700 189 / 6e-63 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.009G028001 189 / 1e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091200 189 / 1e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10017456 pacid=23163186 polypeptide=Lus10017456 locus=Lus10017456.g ID=Lus10017456.BGIv1.0 annot-version=v1.0
ATGGCTCCCAAGGCAGACAAAAAGCCAGCAGAGAAGAAGCCGGCGGAGAAGTCTCCGGCCGCAGCAGAGAAGAAGCCTCGCGCCGAGAAGAAGCTGCCGA
AAGACGGAGGCTCTATCGACAAGAAGAAGAAGAAGGCCAAGAAGAGCGTTGAGACGTACAAGATCTACATCTTCAAGGTCCTGAAGCAGGTCCACCCTGA
CATCGGGATCTCCAGCAAGGCCATGGGGATTATGAACAGCTTCATCAACGATATCTTCGAGAAGCTCGCCCAGGAGTCTTCCAGGCTTGCGAGGTACAAC
AAGAAGCCCACCATCACGTCGAGGGAGATCCAGACCGCTGTCAGGCTTGTTCTTCCAGGAGAGCTCGCTAAGCACGCTGTCTCCGAAGGAACGAAGGCTG
TTACCAAGTTTACTAGCTCTTAG
AA sequence
>Lus10017456 pacid=23163186 polypeptide=Lus10017456 locus=Lus10017456.g ID=Lus10017456.BGIv1.0 annot-version=v1.0
MAPKADKKPAEKKPAEKSPAAAEKKPRAEKKLPKDGGSIDKKKKKAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYN
KKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28720 Histone superfamily protein (.... Lus10017456 0 1
AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 ... Lus10002339 3.5 0.8247
AT5G38660 APE1 acclimation of photosynthesis ... Lus10003077 4.2 0.8267
AT1G77350 unknown protein Lus10018864 4.5 0.8161
AT5G18900 2-oxoglutarate (2OG) and Fe(II... Lus10012014 9.2 0.8024
AT1G72510 Protein of unknown function (D... Lus10008118 9.9 0.8222
AT2G28430 unknown protein Lus10022580 10.8 0.7768
AT2G41475 Embryo-specific protein 3, (AT... Lus10019416 15.2 0.7683
AT3G59920 ATGDI2 RAB GDP dissociation inhibitor... Lus10027094 16.3 0.7967
AT1G07170 PHF5-like protein (.1.2.3) Lus10018253 16.7 0.7647
AT5G18800 Cox19-like CHCH family protein... Lus10012784 18.8 0.7373

Lus10017456 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.