Lus10017460 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25140 85 / 2e-21 OLE1, OLEO1 oleosin 1 (.1)
AT2G25890 69 / 1e-15 Oleosin family protein (.1)
AT5G51210 66 / 4e-14 OLEO3 oleosin3 (.1)
AT3G18570 52 / 1e-08 Oleosin family protein (.1)
AT1G48990 48 / 2e-07 Oleosin family protein (.1)
AT5G40420 47 / 1e-06 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G27660 42 / 4e-05 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT3G01570 40 / 0.0002 Oleosin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028822 126 / 5e-38 AT4G25140 146 / 3e-46 oleosin 1 (.1)
Lus10027161 114 / 1e-32 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10031387 113 / 1e-32 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10039683 110 / 3e-31 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Lus10010943 117 / 4e-31 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10022141 59 / 1e-10 AT4G25140 106 / 3e-28 oleosin 1 (.1)
Lus10017992 50 / 5e-08 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
Lus10032461 50 / 8e-08 AT3G18570 142 / 1e-43 Oleosin family protein (.1)
Lus10041987 49 / 2e-07 AT3G18570 129 / 2e-38 Oleosin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G080000 90 / 1e-23 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.003G150600 89 / 4e-23 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.006G234900 61 / 3e-12 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.012G059400 54 / 1e-09 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
Potri.018G057800 51 / 9e-09 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.001G345800 45 / 3e-06 AT3G01570 140 / 6e-43 Oleosin family protein (.1)
Potri.017G071800 39 / 0.0005 AT3G01570 130 / 4e-39 Oleosin family protein (.1)
Potri.012G083400 38 / 0.001 AT5G40420 97 / 2e-25 oleosin 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Lus10017460 pacid=23163191 polypeptide=Lus10017460 locus=Lus10017460.g ID=Lus10017460.BGIv1.0 annot-version=v1.0
ATGGAACATCATGATCAGATGACACACGGCGGAAGCAGCATGCAGGAGCAGCAGCGACACCCCCCCTGCCCCCCCCCGCCCGGCGCCCGGAGGCGGAACC
ACCCCCCCCGCGCCGCCACGGCCGGCGGATCCCTCCTAGTCCTTTCCGGTCTCATCCTGGCAGCCACCATCATTTTGCTCACCATAGCCACCCCTCTCCT
TGTCCTGTGCAGCCCAGTTCTGGTGCCGGCTGTCATTACCGTGGGGCTCTTGATCACCGGGTTTCTCGCCTCCGGCGGGTTCGGCGTGGCTGCCATCACC
GTCTTGTCCTGGATCTATAGGTATGTGAGCGGGAGGAAGGCGGTGGGAGCGGATTCACTGGAGCAAGCTCGGTCGAAGCTGACGGGGAAGGCGAGGGAGA
TGAAGGATAGGGCGTCGGAGTTTGGACAGCAGCATGTCGGCACCGGCGGTCATCAACAGACTTCTTAA
AA sequence
>Lus10017460 pacid=23163191 polypeptide=Lus10017460 locus=Lus10017460.g ID=Lus10017460.BGIv1.0 annot-version=v1.0
MEHHDQMTHGGSSMQEQQRHPPCPPPPGARRRNHPPRAATAGGSLLVLSGLILAATIILLTIATPLLVLCSPVLVPAVITVGLLITGFLASGGFGVAAIT
VLSWIYRYVSGRKAVGADSLEQARSKLTGKAREMKDRASEFGQQHVGTGGHQQTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Lus10017460 0 1

Lus10017460 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.