Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021443 [exp] 40 / 2e-05 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G226200 [exp] 50 / 5e-09 ND / Potri.008G036000 [exp] 40 / 2e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017461 pacid=23163157 polypeptide=Lus10017461 locus=Lus10017461.g ID=Lus10017461.BGIv1.0 annot-version=v1.0 ATGTGCAGCATGGTTCTCTTTCACTTCCTCCTCCTCCTCCTCCTCTCCCCGCATCTCGGAAACAAATCCTCTTACACCCCGACCGCTACTATGGTTGCCG CAGCAGCGAGGCCGTTGCTAGCGGCCTCGTCATCGGATGCGAACTACGCCACGTTGAAGCCGCGCCCCACTGCTTACGCGGCTTTCCGGAGTTGCTTGCC GAAAGGGTTTCATCGCAATTCAGCCCCGAGCCGCTACATTAACTACCGTCCTCTTGGAAGGACTAGTGGTGGCACAACAACTACATTGTGTGACACCGAC AAAAAGCACTGA
AA sequence Show only first row Show all	>Lus10017461 pacid=23163157 polypeptide=Lus10017461 locus=Lus10017461.g ID=Lus10017461.BGIv1.0 annot-version=v1.0 MCSMVLFHFLLLLLLSPHLGNKSSYTPTATMVAAAARPLLAASSSDANYATLKPRPTAYAAFRSCLPKGFHRNSAPSRYINYRPLGRTSGGTTTTLCDTD KKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017461 [exp]	0	1
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10023208 [exp]	2.0	0.8439
AT5G04530		KCS19	3-ketoacyl-CoA synthase 19 (.1...		Lus10039906 [exp]	4.2	0.8176
AT3G51760			Protein of unknown function (D...		Lus10022661 [exp]	5.0	0.7905
					Lus10025831 [exp]	5.5	0.8269
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008897 [exp]	5.7	0.8164
AT5G50800		SWEET13, AtSWEE...	Nodulin MtN3 family protein (....		Lus10005935 [exp]	8.4	0.7494
AT4G24140		BDG3	alpha/beta-Hydrolases superfam...		Lus10033234 [exp]	9.8	0.7846
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10012510 [exp]	11.7	0.7275
					Lus10001828 [exp]	12.4	0.7491
AT3G04910		ATWNK1, ZIK4, W...	with no lysine (K) kinase 1 (....		Lus10020236 [exp]	13.3	0.7114

Compare expression of checked genes

Lus10017461 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.