Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46560 156 / 2e-51 TIM9, EMB2474 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) AT2G29530 42 / 3e-06 TIM10 Tim10/DDP family zinc finger protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037964 [exp] 172 / 2e-57 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10038695 [exp] 172 / 2e-57 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10028819 [exp] 128 / 1e-40 AT3G46560 110 / 1e-33 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10016453 [exp] 40 / 3e-05 AT2G29530 145 / 2e-47 Tim10/DDP family zinc finger protein (.1.2.3) Lus10040718 [exp] 38 / 0.0001 AT2G29530 146 / 1e-47 Tim10/DDP family zinc finger protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G039100 [exp] 160 / 9e-53 AT3G46560 154 / 1e-50 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Potri.001G246500 [exp] 40 / 1e-05 AT2G29530 139 / 6e-45 Tim10/DDP family zinc finger protein (.1.2.3) Potri.009G039600 [exp] 40 / 1e-05 AT2G29530 141 / 1e-45 Tim10/DDP family zinc finger protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [flax] [poplar] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Lus10017463 pacid=23163105 polypeptide=Lus10017463 locus=Lus10017463.g ID=Lus10017463.BGIv1.0 annot-version=v1.0 ATGGACAAGAACATGCTCGCTGGGCTAGAAGAAGGTATGTCTGAAGAAGACAAGGCCCGTATGGCATCCAAGATCGATCAGCTTCAAATCCGCGACAGTT TGAAGATGTACAACTCTCTTGTGGAGAGATGCTTCACCGACTGCGTTGATAGCTTCACACGCAAGTCGCTGAATAAGCAGGAGGAGACTTGTGTGACGCG ATGTGCCGAGAAGTTCTTGAGGCATTCGATGCGTGTTGGAATGAGGTTTGCTGAGCTCAACCAAGGGGCAGCTACTCCAGATGCCAAACCGTAG
AA sequence Show only first row Show all	>Lus10017463 pacid=23163105 polypeptide=Lus10017463 locus=Lus10017463.g ID=Lus10017463.BGIv1.0 annot-version=v1.0 MDKNMLAGLEEGMSEEDKARMASKIDQLQIRDSLKMYNSLVERCFTDCVDSFTRKSLNKQEETCVTRCAEKFLRHSMRVGMRFAELNQGAATPDAKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46560		TIM9, EMB2474	embryo defective 2474, Tim10/D...		Lus10017463 [exp]	0	1
AT1G59730		ATH7	thioredoxin H-type 7 (.1)		Lus10036696 [exp]	18.2	0.6864
AT3G51990			Protein kinase superfamily pro...		Lus10015478 [exp]	32.0	0.6839
AT4G25560	MYB	LAF1, ATMYB18	LONG AFTER FAR-RED LIGHT 1, my...		Lus10039213 [exp]	56.8	0.6758
AT3G12720	MYB	ATMYB67, AtY53	myb domain protein 67 (.1)		Lus10001226 [exp]	57.2	0.6704
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Lus10033172 [exp]	99.3	0.6423
AT1G24540		CYP86C1	"cytochrome P450, family 86, s...		Lus10036880 [exp]	104.4	0.6211
AT5G15740		RRT1	O-fucosyltransferase family pr...		Lus10026685 [exp]	115.5	0.6113
AT1G65440		GTB1	global transcription factor gr...		Lus10034231 [exp]	118.2	0.5863
AT3G48180			unknown protein		Lus10030823 [exp]	191.0	0.5870
AT5G62040		BFT	brother of FT and TFL1, PEBP (...		Lus10005753 [exp]	210.9	0.5886

Compare expression of checked genes

Lus10017463 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.