Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49400 147 / 2e-47 EMB1129 embryo defective 1129, Nucleic acid-binding, OB-fold-like protein (.1) AT3G18880 145 / 6e-47 Nucleic acid-binding, OB-fold-like protein (.1) AT1G79850 56 / 4e-11 PDE347, CS17, PRPS17, ORE4, RPS17 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1) AT4G30800 42 / 7e-06 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017993 [exp] 160 / 8e-53 AT3G18880 159 / 3e-52 Nucleic acid-binding, OB-fold-like protein (.1) Lus10028815 [exp] 159 / 3e-52 AT3G18880 154 / 4e-50 Nucleic acid-binding, OB-fold-like protein (.1) Lus10035863 [exp] 52 / 2e-09 AT1G79850 131 / 6e-40 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1) Lus10025799 [exp] 52 / 2e-09 AT1G79850 133 / 9e-41 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G150100 [exp] 146 / 3e-47 AT1G49400 152 / 4e-49 embryo defective 1129, Nucleic acid-binding, OB-fold-like protein (.1) Potri.006G080200 [exp] 145 / 1e-46 AT3G18880 155 / 1e-50 Nucleic acid-binding, OB-fold-like protein (.1) Potri.001G184000 [exp] 45 / 5e-07 AT1G79850 139 / 1e-42 PLASTID RIBOSOMAL SMALL SUBUNIT PROTEIN 17, PIGMENT DEFECTIVE 347, ribosomal protein S17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [flax] [poplar] OB PF00366 [flax] [poplar] Ribosomal_S17 Ribosomal protein S17
Representative CDS sequence Show only first row Show all	>Lus10017467 pacid=23163194 polypeptide=Lus10017467 locus=Lus10017467.g ID=Lus10017467.BGIv1.0 annot-version=v1.0 ATGAAATCGGTGGTGGGAGTGGTGGTTTCCAACAAGATGCAGAAATCGGTGGTGGTAGCCGTCGACAGACTCTTCCACAACAAGGTCTACAATCGCTACG TCAAGCGCACCTCTAAGTTCATGGCTCACGACGCCGACGACGCCTGCAACATTGGCGATCGTGTGAAATTGGATCCTTCGCGGCCATTGAGCAAACACAA GCGTTGGATTGTTGCTGACATTCTTAAGAAAGCCCGCATATACATTCCTCCTTCTGCCGCTAATCTGCCTGCTGCATCTCAACTTGCAGCATCATCTTCA ACCTCTTAA
AA sequence Show only first row Show all	>Lus10017467 pacid=23163194 polypeptide=Lus10017467 locus=Lus10017467.g ID=Lus10017467.BGIv1.0 annot-version=v1.0 MKSVVGVVVSNKMQKSVVVAVDRLFHNKVYNRYVKRTSKFMAHDADDACNIGDRVKLDPSRPLSKHKRWIVADILKKARIYIPPSAANLPAASQLAASSS TS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18880			Nucleic acid-binding, OB-fold-...		Lus10017467 [exp]	0	1
AT1G07070			Ribosomal protein L35Ae family...		Lus10021121 [exp]	1.0	0.9179
AT1G27435			unknown protein		Lus10035173 [exp]	6.3	0.8775
AT2G20585		NFD6	nuclear fusion defective 6 (.1...		Lus10039888 [exp]	10.8	0.8755
AT2G33845			Nucleic acid-binding, OB-fold-...		Lus10039889 [exp]	12.4	0.8306
AT2G33845			Nucleic acid-binding, OB-fold-...		Lus10002172 [exp]	12.6	0.8637
AT5G49665			Zinc finger (C3HC4-type RING f...		Lus10028225 [exp]	14.2	0.8646
AT1G21880		LYM1	lysm domain GPI-anchored prote...		Lus10018191 [exp]	15.1	0.8720
AT3G03920			H/ACA ribonucleoprotein comple...		Lus10020289 [exp]	16.1	0.8534
AT4G00250	GeBP		DNA-binding storekeeper protei...		Lus10007188 [exp]	16.1	0.8424
AT5G23570		SGS3, ATSGS3	SUPPRESSOR OF GENE SILENCING 3...		Lus10004302 [exp]	17.1	0.8412

Compare expression of checked genes

Lus10017467 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.