Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56670 98 / 4e-29 Ribosomal protein S30 family protein (.1) AT4G29390 98 / 4e-29 Ribosomal protein S30 family protein (.1) AT2G19750 98 / 4e-29 Ribosomal protein S30 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002508 [exp] 122 / 1e-38 AT4G29390 98 / 4e-29 Ribosomal protein S30 family protein (.1) Lus10028808 [exp] 97 / 8e-29 AT5G56670 73 / 3e-19 Ribosomal protein S30 family protein (.1) Lus10019054 [exp] 66 / 8e-15 AT5G56670 48 / 1e-07 Ribosomal protein S30 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G086600 [exp] 100 / 3e-30 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1) Potri.015G084700 [exp] 100 / 3e-30 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1) Potri.014G147200 [exp] 100 / 3e-30 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04758 [flax] [poplar] Ribosomal_S30 Ribosomal protein S30
Representative CDS sequence Show only first row Show all	>Lus10017473 pacid=23163213 polypeptide=Lus10017473 locus=Lus10017473.g ID=Lus10017473.BGIv1.0 annot-version=v1.0 ATGGGTAAGGTGCACGGTTCTTTGGCTCGTGCCGGTAAGGTGAGGGGACAGACTCCCAAGGTCGCGAAGCAGGAGAAGAAGAAGAGGCCACGCGGCCGTG CTCACAAGAGGGAACAATACAACCGCAGATTCGTCACTGCTGTTGTTGGATTCGGCAAGAAGAGGGGACCAAACTCTTCAGAGAAGTAG
AA sequence Show only first row Show all	>Lus10017473 pacid=23163213 polypeptide=Lus10017473 locus=Lus10017473.g ID=Lus10017473.BGIv1.0 annot-version=v1.0 MGKVHGSLARAGKVRGQTPKVAKQEKKKRPRGRAHKREQYNRRFVTAVVGFGKKRGPNSSEK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G56670			Ribosomal protein S30 family p...		Lus10017473 [exp]	0	1
AT3G11500			Small nuclear ribonucleoprotei...		Lus10017019 [exp]	1.0	0.9635
AT2G20450			Ribosomal protein L14 (.1)		Lus10008246 [exp]	2.4	0.9302
AT2G44860			Ribosomal protein L24e family ...		Lus10020552 [exp]	2.4	0.9181
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10038878 [exp]	3.7	0.9175
AT5G50810		TIM8	translocase inner membrane sub...		Lus10022450 [exp]	3.9	0.9229
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10015000 [exp]	5.9	0.9188
AT3G11500			Small nuclear ribonucleoprotei...		Lus10021342 [exp]	6.3	0.9156
AT5G09500			Ribosomal protein S19 family p...		Lus10021886 [exp]	6.6	0.9120
AT5G23535			KOW domain-containing protein ...		Lus10022069 [exp]	6.9	0.9229
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10008095 [exp]	8.9	0.8659

Compare expression of checked genes

Lus10017473 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.