Lus10017486 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G16430 121 / 1e-32 ATPAP10, PAP10 purple acid phosphatase 10 (.1.2)
AT5G34850 99 / 2e-24 ATPAP26, PAP26 purple acid phosphatase 26 (.1)
AT2G27190 94 / 2e-22 ATPAP12 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 1, purple acid phosphatase 12 (.1)
AT1G56360 87 / 5e-20 PAP6, ATPAP6 purple acid phosphatase 6 (.1)
AT2G18130 86 / 1e-19 PAP11, ATPAP11 purple acid phosphatase 11 (.1)
AT3G46120 80 / 8e-18 ATPAP19, PAP19 purple acid phosphatase 19 (.1)
AT4G36350 79 / 3e-17 ATPAP25, PAP25 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 25, purple acid phosphatase 25 (.1)
AT1G52940 72 / 6e-15 PAP5, ATPAP5 purple acid phosphatase 5 (.1)
AT3G52780 40 / 0.0006 ATPAP20, PAP20 Purple acid phosphatases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028798 218 / 2e-69 AT2G16430 673 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10041959 162 / 6e-48 AT2G16430 731 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10028799 150 / 2e-43 AT2G16430 746 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10017484 149 / 9e-43 AT2G16430 748 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10017485 147 / 4e-42 AT2G16430 671 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10006126 110 / 2e-28 AT2G27190 681 / 0.0 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 1, purple acid phosphatase 12 (.1)
Lus10039978 87 / 4e-20 AT5G34850 784 / 0.0 purple acid phosphatase 26 (.1)
Lus10027710 86 / 2e-19 AT5G34850 790 / 0.0 purple acid phosphatase 26 (.1)
Lus10008054 84 / 4e-19 AT5G34850 774 / 0.0 purple acid phosphatase 26 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G160100 129 / 2e-35 AT2G16430 779 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.009G121200 127 / 1e-34 AT2G16430 773 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.005G233400 126 / 1e-34 AT2G16430 700 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.002G029300 125 / 7e-34 AT2G16430 693 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.006G063700 103 / 5e-26 AT5G34850 798 / 0.0 purple acid phosphatase 26 (.1)
Potri.018G024800 99 / 3e-24 AT5G34850 742 / 0.0 purple acid phosphatase 26 (.1)
Potri.018G123700 94 / 1e-22 AT5G34850 762 / 0.0 purple acid phosphatase 26 (.1)
Potri.003G030700 43 / 5e-05 AT3G52820 607 / 0.0 purple acid phosphatase 22 (.1)
PFAM info
Representative CDS sequence
>Lus10017486 pacid=23163203 polypeptide=Lus10017486 locus=Lus10017486.g ID=Lus10017486.BGIv1.0 annot-version=v1.0
ATGTCGTCTCTCTACTTTCTATTAGCTTTAGGATGGGCTCACAGCAGCACTGCCAATGGCGGCTACACCAGCAGCTTTGTCAGGAGAGACCAGAAGTCCG
TCGACATGCCACTCCACAGCGACGTCTTCCAGCCTCCCTCCGGCTACAACGCTCGTCAGCAGGTTCGAAACTTGACACCAACTTTTGGAGACCATAACGG
GAAGGCAATGATGGTCTCGTGGGCAACCGTGGACGAACCCGGTTCGAGTCAAATGGTTTATTGGAAGGAAGATAGTCCACAAGACAAGAAGGTTGCTGAA
GGAAAACACGAGACTTACAAGTACCATAACTATAATTCTGGCAATATTCACCATTGCACCATCCGAAAGCTTGAGCACGAGGAATCCACAGCCAGAGTAC
TCTGCCTACAGAGAAGCGAGCTTTGGGCGGACATAGAGAACAGGACTCATGCACACTATAGCTGGCATAGGAATCAGGATGGTGTTCCCATGGAGGCTGA
TTCTTTGTGGCTCCGTAACAGATTCTGGAGCCCTAAATTGGATGATTCTACTAGCAATCAGTTCTAA
AA sequence
>Lus10017486 pacid=23163203 polypeptide=Lus10017486 locus=Lus10017486.g ID=Lus10017486.BGIv1.0 annot-version=v1.0
MSSLYFLLALGWAHSSTANGGYTSSFVRRDQKSVDMPLHSDVFQPPSGYNARQQVRNLTPTFGDHNGKAMMVSWATVDEPGSSQMVYWKEDSPQDKKVAE
GKHETYKYHNYNSGNIHHCTIRKLEHEESTARVLCLQRSELWADIENRTHAHYSWHRNQDGVPMEADSLWLRNRFWSPKLDDSTSNQF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G16430 ATPAP10, PAP10 purple acid phosphatase 10 (.1... Lus10017486 0 1
AT1G16310 Cation efflux family protein (... Lus10001768 6.4 0.9495
AT1G12110 CHL1-1, CHL1, B... CHLORINA 1, ARABIDOPSIS THALIA... Lus10032252 10.9 0.9369
AT5G15920 EMB2782, SMC5 EMBRYO DEFECTIVE 2782, structu... Lus10005338 12.8 0.9327
AT2G24560 GDSL-like Lipase/Acylhydrolase... Lus10026405 13.7 0.9212
AT3G58360 TRAF-like family protein (.1) Lus10012948 17.0 0.9214
AT5G17840 DnaJ/Hsp40 cysteine-rich domai... Lus10013632 17.3 0.9268
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10010652 21.2 0.9254
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10039478 22.2 0.9330
AT4G39150 DNAJ heat shock N-terminal dom... Lus10017980 23.5 0.9246
AT5G08100 ASPGA1 asparaginase A1, N-terminal nu... Lus10017879 24.2 0.9234

Lus10017486 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.