Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39080 120 / 1e-32 VHA-A3 vacuolar proton ATPase A3 (.1) AT2G21410 110 / 3e-29 VHA-A2 vacuolar proton ATPase A2 (.1) AT2G28520 96 / 5e-24 VHA-A1 vacuolar proton ATPase A1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017490 [exp] 155 / 6e-45 AT4G39080 1312 / 0.0 vacuolar proton ATPase A3 (.1) Lus10024304 [exp] 117 / 2e-31 AT4G39080 1288 / 0.0 vacuolar proton ATPase A3 (.1) Lus10002104 [exp] 113 / 3e-30 AT4G39080 1226 / 0.0 vacuolar proton ATPase A3 (.1) Lus10036133 [exp] 94 / 2e-23 AT2G28520 1360 / 0.0 vacuolar proton ATPase A1 (.1) Lus10018129 [exp] 94 / 2e-23 AT2G28520 1367 / 0.0 vacuolar proton ATPase A1 (.1) Lus10028796 [exp] 66 / 1e-13 AT4G39080 1193 / 0.0 vacuolar proton ATPase A3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G160400 [exp] 126 / 9e-35 AT4G39080 1245 / 0.0 vacuolar proton ATPase A3 (.1) Potri.009G121400 [exp] 122 / 2e-33 AT4G39080 1300 / 0.0 vacuolar proton ATPase A3 (.1) Potri.005G234100 [exp] 104 / 4e-27 AT2G21410 1194 / 0.0 vacuolar proton ATPase A2 (.1) Potri.002G028600 [exp] 104 / 4e-27 AT2G21410 1187 / 0.0 vacuolar proton ATPase A2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01496 [flax] [poplar] V_ATPase_I V-type ATPase 116kDa subunit family
Representative CDS sequence Show only first row Show all	>Lus10017488 pacid=23163125 polypeptide=Lus10017488 locus=Lus10017488.g ID=Lus10017488.BGIv1.0 annot-version=v1.0 ATGGTAATGTTTCATCAGACGCACCAAGGCCAAGCATATGCTCCACTCCCGAGCGGGGATGAATCGGTCGAGTTGGTAGCAGCAGCCCACGATCCACATG GTCATGAGGAATTCGAGTTCAGTGAAGTCTTCGTTCATCAGATGATACACACAATCGAATTCGTCCTTGGAGCAGTTTCGAACACAGCATCTTACCTCCG TCTATGGGCTCTCAGTCTTGCTCACTCGGAACTGTCCAGTGTATTCTACGAAAAGGTCCTGCTCCTTGCATGGGGATGGGGAGCGCGGGATTCGTTATAT TCCGAGCTTTATTCCTCCTGCTCAAATATTGTTAGTATCTATCTCGCTCTGTAG
AA sequence Show only first row Show all	>Lus10017488 pacid=23163125 polypeptide=Lus10017488 locus=Lus10017488.g ID=Lus10017488.BGIv1.0 annot-version=v1.0 MVMFHQTHQGQAYAPLPSGDESVELVAAAHDPHGHEEFEFSEVFVHQMIHTIEFVLGAVSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGWGARDSLY SELYSSCSNIVSIYLAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39080		VHA-A3	vacuolar proton ATPase A3 (.1)		Lus10017488 [exp]	0	1
AT5G46850			unknown protein		Lus10040093 [exp]	8.1	0.6226
AT5G08139			RING/U-box superfamily protein...		Lus10008874 [exp]	17.3	0.5902
AT1G69330			RING/U-box superfamily protein...		Lus10026648 [exp]	26.5	0.5758
AT5G57300			S-adenosyl-L-methionine-depend...		Lus10000179 [exp]	73.8	0.5139
AT2G28680			RmlC-like cupins superfamily p...		Lus10040867 [exp]	93.3	0.5016
AT4G28020			unknown protein		Lus10008905 [exp]	110.9	0.5144

Compare expression of checked genes

Lus10017488 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.